Mouse Anti-Cattle COL4A2 Antibody (MO-AB-10521R)


Cat: MO-AB-10521R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCattle (Bos taurus)
CloneMO10521R
SpecificityThis antibody binds to Cattle COL4A2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationExtracellular region or secreted

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionCOL4A2 (Collagen Type IV Alpha 2 Chain) is a Protein Coding gene. Diseases associated with COL4A2 include Porencephaly 2 and Hemorrhage, Intracerebral. Among its related pathways are Integrin Pathway and ERK Signaling. Gene Ontology (GO) annotations related to this gene include extracellular matrix structural constituent. An important paralog of this gene is COL4A6.
Product OverviewMouse Anti-Cattle COL4A2 Antibody is a mouse antibody against COL4A2. It can be used for COL4A2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCollagen alpha-2(IV) chain, Fragment; COL4A2
UniProt IDF1N7Q7
Protein RefseqThe length of the protein is 1650 amino acids long.
The sequence is show below: QGQPGPVGPQGYTGPPGLQGFPGLQGRKGDKGQRGAPGITGPKGDVGPRGVSGFPGADGIPGHPGQGGPRGPPGYDGCNGTVGDSGYAGPPGPGGFLGPRGPQGPKGQKGEPYALSSEDRDKYRGEPGEPGLVGLQGPPGRPGPVGQMGPVGAPGRPGPPGPPGPKGQPGNRGLGFYGEKGEKGDMGLQGPGGIPPDNGYVEKPTPVYELLPEQYKGEKGSQGEPGRIGVSLKGEEGVVGFSGPRGAPGIDSEKG.
For Research Use Only | Not For Clinical Use.
Online Inquiry