Mouse Anti-Rat COL4A2 Antibody (MO-AB-24960H)
Cat: MO-AB-24960H
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
Size: | |
Conjugate: | |
Inquiry |
- Product Details
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Rat (Rattus norvegicus) |
Clone | MO24960C |
Specificity | This antibody binds to Rat COL4A2. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | COL4A2 (Collagen Type IV Alpha 2 Chain) is a protein coding gene. Diseases associated with COL4A2 include Porencephaly 2 and Hemorrhage, Intracerebral. Among its related pathways are Integrin Pathway and ERK Signaling. Gene Ontology (GO) annotations related to this gene include extracellular matrix structural constituent. An important paralog of this gene is COL4A6. |
Product Overview | This product is a mouse antibody against COL4A2. It can be used for COL4A2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | Alpha-2 collagen type IV; Col4a2 |
UniProt ID | Q62676 |
Protein Refseq | The length of the protein is 33 amino acids long. The sequence is show below: MDRVRFSASGLPLRGWLLLATVTVGLLAQSVLG. |
See other products for " COL4A2 "
CBMOAB-39653FYA | Mouse Anti-Rhesus COL4A2 Antibody (CBMOAB-39653FYA) |
MO-AB-29661W | Mouse Anti-Dog COL4A2 Antibody (MO-AB-29661W) |
MO-AB-53343W | Mouse Anti-Marmoset COL4A2 Antibody (MO-AB-53343W) |
MO-AB-10521R | Mouse Anti-Cattle COL4A2 Antibody (MO-AB-10521R) |
MO-AB-18199W | Mouse Anti-Chimpanzee COL4A2 Antibody (MO-AB-18199W) |
CBMOAB-71203FYA | Mouse Anti-Zebrafish col4a2 Antibody (CBMOAB-71203FYA) |
For Research Use Only | Not For Clinical Use.
Online Inquiry