Mouse Anti-Cattle COX1 Antibody (MO-AB-10610R)


Cat: MO-AB-10610R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCattle (Bos taurus)
CloneMO10610R
SpecificityThis antibody binds to Cattle COX1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationMitochondrion; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionCOX1 (COX1, Cytochrome C Oxidase Copper Chaperone) is a Protein Coding gene. Among its related pathways are Respiratory electron transport, ATP synthesis by chemiosmotic coupling, and heat production by uncoupling proteins. and Gene Expression.
Product OverviewMouse Anti-Cattle COX1 Antibody is a mouse antibody against COX1. It can be used for COX1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCytochrome c oxidase subunit 1; EC 1.9.3.1; COX1
UniProt IDU3GU87
Protein RefseqThe length of the protein is 514 amino acids long.
The sequence is show below: MFINRWLFSTNHKDIGTLYLLFGAWAGMVGTALSLLIRAELGQPGTLLGDDQIYNVVVTAHAFVMIFFMVMPIMIGGFGNWLVPLMIGAPDMAFPRMNNMSFWLLPPSFLLLLASSMVEAGTGTGWTVYPPLAGNLAHAGASVDLTIFSLHLAGVSSILGAINFITTIINMKPPAMSQYQTPLFVWSVMITAVLLLLSLPVLAAGITMLLTDRNLNTTFFDPAGGGDPILYQHLFWFFGHPEVYILILPGFGMIS.
See other products for " cox1 "
MO-AB-11260HMouse Anti-Malaria parasite cox1 Antibody (MO-AB-11260H)
MO-AB-17352WMouse Anti-Chimpanzee COX1 Antibody (MO-AB-17352W)
MO-DKB-02053WRabbit Anti-COX1 Antibody (MO-DKB-02053W)
CBMOAB-00811CRMouse Anti-Yeast COX1 Antibody (CBMOAB-00811CR)
MO-AB-36944WMouse Anti-Goat COX1 Antibody (MO-AB-36944W)
MO-AB-44147WMouse Anti-Horse COX1 Antibody (MO-AB-44147W)
MO-AB-38968WMouse Anti-Grape cox1 Antibody (MO-AB-38968W)
MO-AB-43023WMouse Anti-Hamsters COX1 Antibody (MO-AB-43023W)
CBMOAB-13800FYAMouse Anti-D. melanogaster Cox1 Antibody (CBMOAB-13800FYA)
MO-AB-30262HMouse Anti-Sugar beet cox1 Antibody (MO-AB-30262H)
For Research Use Only | Not For Clinical Use.
Online Inquiry