Mouse Anti-D. melanogaster Cox1 Antibody (CBMOAB-13800FYA)
Cat: CBMOAB-13800FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
Size: | |
Conjugate: | |
Inquiry |
- Product Details
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Fruit fly (Drosophila melanogaster) |
Clone | MO13800FYA |
Specificity | This antibody binds to fruit fly Cox1. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Cellular Localization | Mitochondrion; Other locations |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | Component of the cytochrome c oxidase, the last enzyme in the mitochondrial electron transport chain which drives oxidative phosphorylation. The respiratory chain contains 3 multisubunit complexes succinate dehydrogenase (complex II, CII), ubiquinol-cytochrome c oxidoreductase (cytochrome b-c1 complex, complex III, CIII) and cytochrome c oxidase (complex IV, CIV), that cooperate to transfer electrons derived from NADH and succinate to molecular oxygen, creating an electrochemical gradient over the inner membrane that drives transmembrane transport and the ATP synthase. Cytochrome c oxidase is the component of the respiratory chain that catalyzes the reduction of oxygen to water. Electrons originating from reduced cytochrome c in the intermembrane space (IMS) are transferred via the dinuclear copper A center (CU(A)) of subunit 2 and heme A of subunit 1 to the active site in subunit 1, a binuclear center (BNC) formed by heme A3 and copper B (CU(B)). The BNC reduces molecular oxygen to 2 water molecules using 4 electrons from cytochrome c in the IMS and 4 protons from the mitochondrial matrix. |
Product Overview | Mouse Anti-D. melanogaster Cox1 Antibody is a mouse antibody against Cox1. It can be used for Cox1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | Cytochrome c oxidase subunit 1; EC 1.9.3.1; Fragment; cox1 |
UniProt ID | J7FKZ4 |
Protein Refseq | The length of the protein is 511 amino acids long. The sequence is show below: SRQWLFSTNHKDIGTLYFIFGAWAGMVGTSLSILIRAELGHPGALIGDDQIYNVIVTAHAFIMIFFMVMPIMIGGFGNWLVPLMLGAPDMAFPRMNNMSFWLLPPALSLLLVSSMVENGAGTGWTVYPPLSAGIAHGGASVDLAIFSLHLAGISSILGAVNFITTVINMRSTGISLDRMPLFVWSVVITALLLLLSLPVLAGAITMLLTDRNLNTSFFDPAGGGDPILYQHLFWFFGHPEVYILILPGFGMISHIISQESGKKETFGSLGMIYAMLAIGLLGFIVWAHHMFTVGMDVDTRAYFTSATMIIAVPTGIKIFSWLATLHGTQLSYSPAILWALGFVFLFTVGGLTGVVLANSSVDIILHDTYYVVAHFHYVLSMGAVFAIMAGFIHWYPLFTGLTLNNKWLKSHFIIMFIGVNLTFFPQHFLGLAGMPRRYSDYPDAYTTWNIVSTIGSTISLLGILFFFFIIWESLVSQRQVIYPIHLNSSIEWYQNTPPAEHSYSELPLLTN. |
See other products for " COX1 "
MO-AB-36944W | Mouse Anti-Goat COX1 Antibody (MO-AB-36944W) |
MO-AB-28310W | Mouse Anti-Cucumber cox1 Antibody (MO-AB-28310W) |
CBMOAB-00811CR | Mouse Anti-Yeast COX1 Antibody (CBMOAB-00811CR) |
MO-AB-32986H | Mouse Anti-Nile tilapia COX1 Antibody (MO-AB-32986H) |
MO-AB-10610R | Mouse Anti-Cattle COX1 Antibody (MO-AB-10610R) |
MO-AB-43023W | Mouse Anti-Hamsters COX1 Antibody (MO-AB-43023W) |
MO-AB-05358Y | Mouse Anti-A. aegpti COX1 Antibody (MO-AB-05358Y) |
MO-AB-01374Y | Mouse Anti-Chicken COX1 Antibody (MO-AB-01374Y) |
CBMOAB-26448FYC | Mouse Anti-Arabidopsis COX1 Antibody (CBMOAB-26448FYC) |
MO-AB-11039Y | Mouse Anti-O. mykiss COX1 Antibody (MO-AB-11039Y) |
For Research Use Only | Not For Clinical Use.
Online Inquiry