Mouse Anti-Cattle COX7C Antibody (MO-AB-10645R)
Cat: MO-AB-10645R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
| Size: | |
| Conjugate: | |
| Inquiry |
- Product Details
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Cattle (Bos taurus) |
| Clone | MO10645R |
| Specificity | This antibody binds to Cattle COX7C. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
| Cellular Localization | Mitochondrion; Other locations |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | COX7C (Cytochrome C Oxidase Subunit 7C) is a Protein Coding gene. Among its related pathways are Respiratory electron transport, ATP synthesis by chemiosmotic coupling, and heat production by uncoupling proteins. and Gene Expression. Gene Ontology (GO) annotations related to this gene include cytochrome-c oxidase activity. |
| Product Overview | Mouse Anti-Cattle COX7C Antibody is a mouse antibody against COX7C. It can be used for COX7C detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | Cytochrome c oxidase subunit 7C, mitochondrial; Cytochrome c oxidase polypeptide VIIIA; Cytochrome c oxidase polypeptide VIIc; COX7C; COX7CP1 |
| UniProt ID | P00430 |
| Protein Refseq | The length of the protein is 63 amino acids long. The sequence is show below: MLGQSIRRFTTSVVRRSHYEEGPGKNIPFSVENKWRLLAMMTLFFGSGFAAPFFIVRHQLLKK. |
See other products for " Cox7C "
| CBMOAB-13818FYA | Mouse Anti-D. melanogaster Cox7C Antibody (CBMOAB-13818FYA) |
| MO-AB-19819W | Mouse Anti-Chimpanzee COX7C Antibody (MO-AB-19819W) |
| MO-AB-02609H | Mouse Anti-Frog cox7c Antibody (MO-AB-02609H) |
| MO-AB-25022H | Mouse Anti-Rat Cox7c Antibody (MO-AB-25022H) |
| CBMOAB-71411FYA | Mouse Anti-Zebrafish cox7c Antibody (CBMOAB-71411FYA) |
For Research Use Only | Not For Clinical Use.
Online Inquiry