Mouse Anti-Frog cox7c Antibody (MO-AB-02609H)


Cat: MO-AB-02609H
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityFrog (Xenopus laevis)
CloneMO02609C
SpecificityThis antibody binds to Frog cox7c.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionCOX7C (Cytochrome C Oxidase Subunit 7C) is a Protein Coding gene. Among its related pathways are Respiratory electron transport, ATP synthesis by chemiosmotic coupling, and heat production by uncoupling proteins. and Gene Expression. Gene Ontology (GO) annotations related to this gene include cytochrome-c oxidase activity.
Product OverviewThis product is a mouse antibody against cox7c. It can be used for cox7c detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesMGC85582 protein; cox7c; MGC85582
UniProt IDQ66KN3
Protein RefseqThe length of the protein is 63 amino acids long.
The sequence is show below: MFGQTVRRFATSAIRRSHYEEGPGKNLPFSVENKWRLLGMMTLFFGSGFAFPFIIVRHQLLKK.
See other products for " Cox7c "
MO-AB-25022HMouse Anti-Rat Cox7c Antibody (MO-AB-25022H)
MO-AB-10645RMouse Anti-Cattle COX7C Antibody (MO-AB-10645R)
CBMOAB-71411FYAMouse Anti-Zebrafish cox7c Antibody (CBMOAB-71411FYA)
MO-AB-19819WMouse Anti-Chimpanzee COX7C Antibody (MO-AB-19819W)
CBMOAB-13818FYAMouse Anti-D. melanogaster Cox7C Antibody (CBMOAB-13818FYA)
For Research Use Only | Not For Clinical Use.
Online Inquiry