Mouse Anti-Cattle CXCL12 Antibody (MO-AB-10967R)
Cat: MO-AB-10967R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
| Size: | |
| Conjugate: | |
| Inquiry |
- Product Details
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Cattle (Bos taurus) |
| Clone | MO10967R |
| Specificity | This antibody binds to Cattle CXCL12. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
| Cellular Localization | Extracellular region or secreted; Plasma membrane |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | CXCL12 (C-X-C Motif Chemokine Ligand 12) is a Protein Coding gene. Diseases associated with CXCL12 include Human Immunodeficiency Virus Type 1 and Aids Dementia Complex. Among its related pathways are Apoptotic Pathways in Synovial Fibroblasts and PAK Pathway. Gene Ontology (GO) annotations related to this gene include receptor binding and chemokine activity. |
| Product Overview | Mouse Anti-Cattle CXCL12 Antibody is a mouse antibody against CXCL12. It can be used for CXCL12 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | CXCL12 protein; CXCL12 |
| UniProt ID | Q0P5I9 |
| Protein Refseq | The length of the protein is 89 amino acids long. The sequence is show below: MDAKVFVVLALVLTALCLSDAKPVSLSYRCPCRFFESHVAKANVKHLKILNTPNCSLQIVARLKNNNRQVCIDPKLKWIQEYLDKALNK. |
See other products for " CXCL12 "
| MO-AB-20721W | Mouse Anti-Chimpanzee CXCL12 Antibody (MO-AB-20721W) |
| MO-AB-24987R | Mouse Anti-Pig CXCL12 Antibody (MO-AB-24987R) |
| MO-AB-01477Y | Mouse Anti-Chicken CXCL12 Antibody (MO-AB-01477Y) |
| MO-AB-25212H | Mouse Anti-Rat Cxcl12 Antibody (MO-AB-25212H) |
| MO-AB-08165W | Mouse Anti-Cat CXCL12 Antibody (MO-AB-08165W) |
| MO-AB-29962W | Mouse Anti-Dog CXCL12 Antibody (MO-AB-29962W) |
| CBMOAB-40150FYA | Mouse Anti-Rhesus CXCL12 Antibody (CBMOAB-40150FYA) |
For Research Use Only | Not For Clinical Use.
Online Inquiry