Mouse Anti-Pig CXCL12 Antibody (MO-AB-24987R)


Cat: MO-AB-24987R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityPig (Sus scrofa)
CloneMO24987R
SpecificityThis antibody binds to Pig CXCL12.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationExtracellular region or secreted; Plasma membrane

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionCXCL12 (C-X-C Motif Chemokine Ligand 12) is a Protein Coding gene. Diseases associated with CXCL12 include Human Immunodeficiency Virus Type 1 and Aids Dementia Complex. Among its related pathways are Apoptotic Pathways in Synovial Fibroblasts and PAK Pathway. Gene Ontology (GO) annotations related to this gene include receptor binding and chemokine activity.
Product OverviewThis product is a mouse antibody against CXCL12. It can be used for CXCL12 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCXCL12 chemokine; Putative CXCL12 chemokine; SDF-1; CXCL12
UniProt IDQ6EKW4
Protein RefseqThe length of the protein is 116 amino acids long.
The sequence is show below: MGVKVLAVLALVLTALCLSDEKPVSLSYRCPCRFFESHVARANIKHLKILNTPNCALQIVARLKSNNRQVCIDPKLKWIQEYLEKALNKPSPTLSGLTSALGSSLASTTVGITSRS.
For Research Use Only | Not For Clinical Use.
Online Inquiry