Mouse Anti-Cattle CXCR3 Antibody (MO-AB-10983R)


Cat: MO-AB-10983R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCattle (Bos taurus)
CloneMO10983R
SpecificityThis antibody binds to Cattle CXCR3.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationPlasma membrane; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionCXCR3 (C-X-C Motif Chemokine Receptor 3) is a Protein Coding gene. Diseases associated with CXCR3 include Cutaneous Lupus Erythematosus and Pulmonary Sarcoidosis. Among its related pathways are Akt Signaling and Peptide ligand-binding receptors. Gene Ontology (GO) annotations related to this gene include G-protein coupled receptor activity and chemokine receptor activity. An important paralog of this gene is CXCR5.
Product OverviewMouse Anti-Cattle CXCR3 Antibody is a mouse antibody against CXCR3. It can be used for CXCR3 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesC-X-C chemokine receptor type 3; CXC-R3; CXCR-3; Interferon-inducible protein 10 receptor; IP-10 receptor; CD antigen CD183; CXCR3
UniProt IDQ5MD61
Protein RefseqThe length of the protein is 366 amino acids long.
The sequence is show below: MVPEMSERQEFQASDFAYLLENSSYDYGENETYFCCTSPPCPQDFSLNFDRTFLPVLYSLLFVLGLLGNGIVAVVLLSQRAALSSTDTFLLHLAVADALLVLTLPLWAVDAAIQWVFGSGLCKVAGALFNINFYAGALLLACISFDRYLSIVHATQLYRRGPPTRVALTCVAVWGLCLLFALPDFIFLSSHHDNRLNATHCQYNFPQEGHTALRILQLVAGFLLPLLVMAYCYARILAVLLVSRGQRRLRAMRLV.
For Research Use Only | Not For Clinical Use.
Online Inquiry