Mouse Anti-Rat Cxcr3 Antibody (MO-AB-25223H)
Cat: MO-AB-25223H
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
Size: | |
Conjugate: | |
Inquiry |
- Product Details
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Rat (Rattus norvegicus) |
Clone | MO25223C |
Specificity | This antibody binds to Rat Cxcr3. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | CXCR3 (C-X-C Motif Chemokine Receptor 3) is a protein coding gene. Diseases associated with CXCR3 include Cutaneous Lupus Erythematosus and Pulmonary Sarcoidosis. Among its related pathways are Akt Signaling and Peptide ligand-binding receptors. Gene Ontology (GO) annotations related to this gene include G-protein coupled receptor activity and chemokine receptor activity. An important paralog of this gene is CXCR5. |
Product Overview | This product is a mouse antibody against Cxcr3. It can be used for Cxcr3 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | C-X-C chemokine receptor type 3; Cxcr3 |
UniProt ID | A0A096MIV9 |
Protein Refseq | The length of the protein is 33 amino acids long. The sequence is show below: MYLEVSERQVLDASDIAFLLENSTSPYDYGENE. |
See other products for " CXCR3 "
CBMOAB-40160FYA | Mouse Anti-Rhesus CXCR3 Antibody (CBMOAB-40160FYA) |
MO-AB-24994R | Mouse Anti-Pig CXCR3 Antibody (MO-AB-24994R) |
MO-AB-10983R | Mouse Anti-Cattle CXCR3 Antibody (MO-AB-10983R) |
MO-AB-29970W | Mouse Anti-Dog CXCR3 Antibody (MO-AB-29970W) |
MO-DKB-00805W | Rabbit Anti-CXCR3 Antibody (MO-DKB-00805W) |
MO-AB-37032W | Mouse Anti-Goat CXCR3 Antibody (MO-AB-37032W) |
MO-AB-11134Y | Mouse Anti-O. mykiss CXCR3 Antibody (MO-AB-11134Y) |
MO-AB-34645W | Mouse Anti-Ferret CXCR3 Antibody (MO-AB-34645W) |
For Research Use Only | Not For Clinical Use.
Online Inquiry