Mouse Anti-Cattle CXCR4 Antibody (MO-AB-10984R)
Cat: MO-AB-10984R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
Size: | |
Conjugate: | |
Inquiry |
- Product Details
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Cattle (Bos taurus) |
Clone | MO10984R |
Specificity | This antibody binds to Cattle CXCR4. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Cellular Localization | Plasma membrane; Lysosome; Endosome; Other locations |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | Receptor for the C-X-C chemokine CXCL12/SDF-1 that transduces a signal by increasing intracellular calcium ion levels and enhancing MAPK1/MAPK3 activation. Involved in the AKT signaling cascade (By similarity). Plays a role in regulation of cell migration, e.g. during wound healing. Acts as a receptor for extracellular ubiquitin; leading to enhanced intracellular calcium ions and reduced cellular cAMP levels. Binds bacterial lipopolysaccharide (LPS) et mediates LPS-induced inflammatory response, including TNF secretion by monocytes (By similarity). Involved in hematopoiesis and in cardiac ventricular septum formation. Also plays an essential role in vascularization of the gastrointestinal tract, probably by regulating vascular branching and/or remodeling processes in endothelial cells. Involved in cerebellar development. In the CNS, could mediate hippocampal-neuron survival (By similarity). |
Product Overview | Mouse Anti-Cattle CXCR4 Antibody is a mouse antibody against CXCR4. It can be used for CXCR4 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | C-X-C chemokine receptor type 4; CXC-R4; CXCR-4; Fusin; LCR1; Leukocyte-derived seven transmembrane domain receptor; LESTR; Stromal cell-derived factor 1 receptor; SDF-1 receptor; CD antigen CD184; CXCR4 |
UniProt ID | P25930 |
Protein Refseq | The length of the protein is 353 amino acids long. The sequence is show below: MEGIRIFTSDNYTEDDLGSGDYDSMKEPCFREENAHFNRIFLPTVYSIIFLTGIVGNGLVILVMGYQKKLRSMTDKYRLHLSVADLLFVLTLPFWAVDAVANWYFGKFLCKAVHVIYTVNLYSSVLILAFISLDRYLAIVHATNSQKPRKLLAEKVVYVGVWLPAVLLTIPDLIFADIKEVDERYICDRFYPSDLWLVVFQFQHIVVGLLLPGIVILSCYCIIISKLSHSKGYQKRKALKTTVILILTFFACWLP. |
See other products for " CXCR4 "
MO-AB-00284R | Mouse Anti-Medaka CXCR4 Antibody (MO-AB-00284R) |
CBMOAB-40162FYA | Mouse Anti-Rhesus CXCR4 Antibody (CBMOAB-40162FYA) |
MO-AB-34646W | Mouse Anti-Ferret CXCR4 Antibody (MO-AB-34646W) |
MO-AB-24995R | Mouse Anti-Pig CXCR4 Antibody (MO-AB-24995R) |
MO-AB-53773W | Mouse Anti-Marmoset CXCR4 Antibody (MO-AB-53773W) |
MO-AB-14787Y | Mouse Anti-Sheep CXCR4 Antibody (MO-AB-14787Y) |
MO-AB-07759Y | Mouse Anti-Rabbit CXCR4 Antibody (MO-AB-07759Y) |
MO-AB-29972W | Mouse Anti-Dog CXCR4 Antibody (MO-AB-29972W) |
MO-AB-16037W | Mouse Anti-Chimpanzee CXCR4 Antibody (MO-AB-16037W) |
MO-AB-08180W | Mouse Anti-Cat CXCR4 Antibody (MO-AB-08180W) |
For Research Use Only | Not For Clinical Use.
Online Inquiry