Mouse Anti-Medaka CXCR4 Antibody (MO-AB-00284R)


Cat: MO-AB-00284R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityMedaka (Oryzias latipes)
CloneMO00284R
SpecificityThis antibody binds to Medaka CXCR4.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionReceptor for the C-X-C chemokine CXCL12/SDF-1 that transduces a signal by increasing intracellular calcium ion levels and enhancing MAPK1/MAPK3 activation. Involved in the AKT signaling cascade (By similarity). Plays a role in regulation of cell migration, e.g. during wound healing. Acts as a receptor for extracellular ubiquitin; leading to enhanced intracellular calcium ions and reduced cellular cAMP levels. Binds bacterial lipopolysaccharide (LPS) et mediates LPS-induced inflammatory response, including TNF secretion by monocytes (By similarity). Involved in hematopoiesis and in cardiac ventricular septum formation. Also plays an essential role in vascularization of the gastrointestinal tract, probably by regulating vascular branching and/or remodeling processes in endothelial cells. Involved in cerebellar development. In the CNS, could mediate hippocampal-neuron survival (By similarity).
Product OverviewThis product is a mouse antibody against CXCR4. It can be used for CXCR4 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesChemokine (C-X-C motif) receptor 4, Fragment; CXCR4
UniProt IDQ1PQK6
Protein RefseqThe length of the protein is 316 amino acids long.
The sequence is show below: MEYFYESIVFDNSSEGILDGSGDFEFPEEAYKEALSRDFKKIFLPTVYGVIFVLGIVGNGLVVVVMGYQKKVKNMTDKYRLHLSVADLLLVLTLPFWAVDAVKTWYFGGFVCVSAHVIYTVNLYSSVLILAFISLDRYLAIVRATNSQATRKLLASRVIYVGVWLPAAFLTVPDLVFARVKSVSSPSFSFRNDSVEMEDSRTICERFYPVESRVVWTVIFRFQHILVGFILPGLVILVCYCIIIAKLSKGTKGQTLKKRALKTTVILILCFFCCWLPYCIGIFLDTLMMLNVVRTTYELQQALDKWISITEALAYF.
For Research Use Only | Not For Clinical Use.
Online Inquiry