Mouse Anti-Cattle CYB5R3 Antibody (MO-AB-11001R)


Cat: MO-AB-11001R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCattle (Bos taurus)
CloneMO11001R
SpecificityThis antibody binds to Cattle CYB5R3.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionCYB5R3 (Cytochrome B5 Reductase 3) is a Protein Coding gene. Diseases associated with CYB5R3 include Methemoglobinemia Due To Deficiency Of Methemoglobin Reductase and Hereditary Methemoglobinemia. Among its related pathways are Innate Immune System and Metabolism. Gene Ontology (GO) annotations related to this gene include oxidoreductase activity and NAD binding. An important paralog of this gene is CYB5R1.
Product OverviewMouse Anti-Cattle CYB5R3 Antibody is a mouse antibody against CYB5R3. It can be used for CYB5R3 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesNADH-cytochrome b5 reductase 3, Fragment; CYB5R3
UniProt IDF1N7T1
Protein RefseqThe length of the protein is 302 amino acids long.
The sequence is show below: LGSALSFQLGHVVLSPVWFLYSLIMKLFQRSTPAITLENPDIKYPLRLIDKEVISHDTRRFRFALPSPEHILGLPVGQHIYLSARIDGNLVIRPYTPVSSDDDKGFVDLVIKVYFKDTHPKFPAGGKMSQYLESMKIGDTIEFRGPNGLLVYQGKGKFAIRPDKKSDPVIKTVKSVGMIAGGTGITPMLQVIRAIMKDPDDHTVCHLLFANQTEKDILLRPELEELRNEHSARFKLWYTVDKAPEAWDYSQGFVN.
For Research Use Only | Not For Clinical Use.
Online Inquiry