Mouse Anti-Cattle CYBB Antibody (MO-AB-11007R)


Cat: MO-AB-11007R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCattle (Bos taurus)
CloneMO11007R
SpecificityThis antibody binds to Cattle CYBB.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationPlasma membrane; Lysosome; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionCYBB (Cytochrome B-245 Beta Chain) is a Protein Coding gene. Diseases associated with CYBB include Immunodeficiency 34 and Granulomatous Disease, Chronic, X-Linked. Among its related pathways are Innate Immune System and RET signaling. Gene Ontology (GO) annotations related to this gene include protein heterodimerization activity and heme binding. An important paralog of this gene is NOX1.
Product OverviewMouse Anti-Cattle CYBB Antibody is a mouse antibody against CYBB. It can be used for CYBB detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCytochrome b-245 heavy chain; EC 1.-.-.-; CGD91-phox; Cytochrome b(558) subunit beta; Cytochrome b558 subunit beta; Heme-binding membrane glycoprotein gp91phox; Neutrophil cytochrome b 91 kDa polypeptide; gp91-1; gp91-phox; p22 phagocyte B-cytochrome; CYBB
UniProt IDO46522
Protein RefseqThe length of the protein is 570 amino acids long.
The sequence is show below: MGNWVVNEGISIFVILVWLGMNVFLFVWYYRVYDIPDKFFYTRKLLGSALALARAPAACLNFNCMLILLPVCRNLLSFLRGSSACCSTRIRRQLDRNLTFHKMVAWMIALHTAIHTIAHLFNVEWCVNARVNNSDPYSIALSDIGDKPNETYLNFVRQRIKNPEGGLYVAVTRLAGITGVVITLCLILIITSSTKTIRRSYFEVFWYTHHLFVIFFIGLAIHGAQRIVRGQTAESLLKHQPRNCYQNISQWGKIE.
For Research Use Only | Not For Clinical Use.
Online Inquiry