Mouse Anti-Sheep CYBB Antibody (MO-AB-14791Y)
Cat: MO-AB-14791Y
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
Size: | |
Conjugate: | |
Inquiry |
- Product Details
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Sheep (Ovis aries) |
Clone | MO14791Y |
Specificity | This antibody binds to Sheep CYBB. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | CYBB (Cytochrome B-245 Beta Chain) is a Protein Coding gene. Diseases associated with CYBB include Immunodeficiency 34 and Granulomatous Disease, Chronic, X-Linked. Among its related pathways are Innate Immune System and RET signaling. Gene Ontology (GO) annotations related to this gene include protein heterodimerization activity and heme binding. An important paralog of this gene is NOX1. |
Product Overview | This product is a mouse antibody against CYBB. It can be used for CYBB detection in Western Blot and Enzyme-Linked Immunosorbent Assay. |
Alternative Names | Cytochrome b-245 beta polypeptide; CYBB |
UniProt ID | Q30DU3 |
Protein Refseq | The length of the protein is 64 amino acids long. The sequence is show below: LQEKNNTGFLSYNIYLTGWDESQASHFAVHHDEEKDVITGLKQKTLYGRPNWDNEFKTIGSQHP. |
See other products for " CYBB "
MO-AB-11007R | Mouse Anti-Cattle CYBB Antibody (MO-AB-11007R) |
MO-AB-29982W | Mouse Anti-Dog CYBB Antibody (MO-AB-29982W) |
MO-AB-07767Y | Mouse Anti-Rabbit CYBB Antibody (MO-AB-07767Y) |
CBMOAB-72540FYA | Mouse Anti-Zebrafish cybb Antibody (CBMOAB-72540FYA) |
CBMOAB-40204FYA | Mouse Anti-Rhesus CYBB Antibody (CBMOAB-40204FYA) |
CBMOAB-0468YC | Mouse Anti-E. coli cybB Antibody (CBMOAB-0468YC) |
For Research Use Only | Not For Clinical Use.
Online Inquiry