Mouse Anti-Cattle CYC1 Antibody (MO-AB-11009R)


Cat: MO-AB-11009R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCattle (Bos taurus)
CloneMO11009R
SpecificityThis antibody binds to Cattle CYC1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationOther locations; Mitochondrion; Cytosol; Nucleus

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionElectron carrier protein. The oxidized form of the cytochrome c heme group can accept an electron from the heme group of the cytochrome c1 subunit of ubiquinol-cytochrome c oxidoreductase. Cytochrome c then transfers this electron to the dinuclear copper A center (CU(A)) of the COX2 subunit of cytochrome oxidase, the final protein carrier in the mitochondrial electron-transport chain. Isoform 1 (CYC1) is the predominant cytochrome c during aerobic/normoxic growth.
Product OverviewMouse Anti-Cattle CYC1 Antibody is a mouse antibody against CYC1. It can be used for CYC1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCytochrome c1, heme protein, mitochondrial; Complex III subunit 4; Complex III subunit IV; Cytochrome b-c1 complex subunit 4; Ubiquinol-cytochrome-c reductase complex cytochrome c1 subunit; Cytochrome c-1; CYC1
UniProt IDP00125
Protein RefseqThe length of the protein is 325 amino acids long.
The sequence is show below: MAAAAATLRGAMVGPRGAGLPGARARGLLCGARPGQLPLRTPQAVSLSSKSGLSRGRKVILSALGMLAAGGAGLAVALHSAVSASDLELHPPSYPWSHRGLLSSLDHTSIRRGFQVYKQVCSSCHSMDYVAYRHLVGVCYTEDEAKALAEEVEVQDGPNEDGEMFMRPGKLSDYFPKPYPNPEAARAANNGALPPDLSYIVRARHGGEDYVFSLLTGYCEPPTGVSLREGLYFNPYFPGQAIGMAPPIYNEVLEF.
See other products for " CYC1 "
MO-AB-34339HMouse Anti-Tomato CYC1 Antibody (MO-AB-34339H)
MO-AB-53805WMouse Anti-Marmoset CYC1 Antibody (MO-AB-53805W)
CBMOAB-00932CRMouse Anti-Yeast CYC1 Antibody (CBMOAB-00932CR)
MO-AB-10284WMouse Anti-Chimpanzee CYC1 Antibody (MO-AB-10284W)
MO-DKB-01132WRabbit Anti-CYC1 Antibody (MO-DKB-01132W)
MO-AB-25234HMouse Anti-Rat Cyc1 Antibody (MO-AB-25234H)
MO-DKB-0151RARabbit Anti-Cyc1 Antibody (MO-DKB-0151RA)
MO-AB-02776HMouse Anti-Frog cyc1 Antibody (MO-AB-02776H)
MO-DKB-02066WRabbit Anti-CYC1 Antibody (MO-DKB-02066W)
CBMOAB-40206FYAMouse Anti-Rhesus CYC1 Antibody (CBMOAB-40206FYA)
For Research Use Only | Not For Clinical Use.
Online Inquiry