Mouse Anti-Marmoset CYC1 Antibody (MO-AB-53805W)


Cat: MO-AB-53805W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityMarmoset
CloneMO53805W
SpecificityThis antibody binds to Marmoset CYC1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus; Mitochondrion; Cytosol

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionCYC1 (Cytochrome C1) is a Protein Coding gene. Diseases associated with CYC1 include Mitochondrial Complex Iii Deficiency, Nuclear Type 6 and Isolated Complex Iii Deficiency. Among its related pathways are Respiratory electron transport, ATP synthesis by chemiosmotic coupling, and heat production by uncoupling proteins. and Metabolism. Gene Ontology (GO) annotations related to this gene include iron ion binding and electron transfer activity.
Product OverviewMouse Anti-Marmoset CYC1 Antibody is a mouse antibody against CYC1. It can be used for CYC1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCytochrome c1, heme protein, mitochondrial; CYC1
UniProt IDU3FUP4
Protein RefseqThe length of the protein is 325 amino acids long.
The sequence is show below: MASAAASLRGAVLGPRGAGLPGARARGLLCSARPGQLPLRTPQAVPLSSKPGLSRGRKVMLSALGMLAAGGAGLTLALHSAVSASDLELHAPSYPWSHRGLLSSLDHTSIRRGFQVYKQVCSSCHSMDYVAYRHLVGVCYTEAEAKALAEEVEVQDGPNEDGEMFMRPGKLSDYFPKPYPNPEAARAANNGALPPDLSYIVRARHGGEDYIFSLLTGYCEPPTGVSLREGLYFNPYFPGQAIGMAPPIYTDVLEFDDGTPATMSQVAKDVCTFLRWASEPEHDQRKRMGLKMLMMMSLLVPLIYTMKRHKWSVLKSRKLAYRPPK.
For Research Use Only | Not For Clinical Use.
Online Inquiry