Mouse Anti-Zebrafish cyc1 Antibody (CBMOAB-72549FYA)


Cat: CBMOAB-72549FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio)
CloneMO72549FYA
SpecificityThis antibody binds to Zebrafish cyc1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationMitochondrion

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionCYC1 (Cytochrome C1) is a Protein Coding gene. Diseases associated with CYC1 include Mitochondrial Complex Iii Deficiency, Nuclear Type 6 and Isolated Complex Iii Deficiency. Among its related pathways are Respiratory electron transport, ATP synthesis by chemiosmotic coupling, and heat production by uncoupling proteins. and Metabolism. Gene Ontology (GO) annotations related to this gene include iron ion binding and electron transfer activity.
Product OverviewMouse Anti-Zebrafish cyc1 Antibody is a mouse antibody against cyc1. It can be used for cyc1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCytochrome c-1; cyc
UniProt IDQ3B7R0
Protein RefseqThe length of the protein is 307 amino acids long.
The sequence is show below: MAALRVVVFSGTGRTLLNTSKAFHTPRASMSFASLPKGKKIALTTIGVLTTGGAGLALMLQQSVKASDLELHPPTYPWSHGGFLSSLDHASVRRGYQVYKQVCSACHSMEYLAFRNLVGVSHTEDEVKTLAEEIEVVDGPDDNGEMFTRPGKLSDYFPKPYANPEAARAANNGALPPDLSYIVNARHGGEDYVFSLLTGYCDPPAGVSLREGLYYNPYFPGQAIGMAPPIYNEVLEYDDGTPATMSQVAKDVCTFLRWAAEPEHDDRKRMGLKVLLGGALLIPLIYYIKRHKWSVLKSRKIAYRPPK.
See other products for " CYC1 "
CBMOAB-40206FYAMouse Anti-Rhesus CYC1 Antibody (CBMOAB-40206FYA)
CBMOAB-02322HCBMouse Anti-C. elegans CYC1 Antibody (CBMOAB-02322HCB)
MO-DKB-0151RARabbit Anti-Cyc1 Antibody (MO-DKB-0151RA)
CBMOAB-00932CRMouse Anti-Yeast CYC1 Antibody (CBMOAB-00932CR)
MO-DKB-01132WRabbit Anti-CYC1 Antibody (MO-DKB-01132W)
MO-AB-02776HMouse Anti-Frog cyc1 Antibody (MO-AB-02776H)
MO-AB-11009RMouse Anti-Cattle CYC1 Antibody (MO-AB-11009R)
MO-AB-34339HMouse Anti-Tomato CYC1 Antibody (MO-AB-34339H)
MO-AB-10284WMouse Anti-Chimpanzee CYC1 Antibody (MO-AB-10284W)
MO-DKB-02066WRabbit Anti-CYC1 Antibody (MO-DKB-02066W)
For Research Use Only | Not For Clinical Use.
Online Inquiry