Mouse Anti-Cattle DAZL Antibody (MO-AB-11186R)
Cat: MO-AB-11186R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
Size: | |
Conjugate: | |
Inquiry |
- Product Details
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Cattle (Bos taurus) |
Clone | MO11186R |
Specificity | This antibody binds to Cattle DAZL. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Cellular Localization | Nucleus; Other locations |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | The DAZ (Deleted in AZoospermia) gene family encodes potential RNA binding proteins that are expressed in prenatal and postnatal germ cells of males and females. The protein encoded by this gene is localized to the nucleus and cytoplasm of fetal germ cells and to the cytoplasm of developing oocytes. In the testis, this protein is localized to the nucleus of spermatogonia but relocates to the cytoplasm during meiosis where it persists in spermatids and spermatozoa. Transposition and amplification of this autosomal gene during primate evolution gave rise to the DAZ gene cluster on the Y chromosome. Mutations in this gene have been linked to severe spermatogenic failure and infertility in males. Two transcript variants encoding different isoforms have been found for this gene. |
Product Overview | Mouse Anti-Cattle DAZL Antibody is a mouse antibody against DAZL. It can be used for DAZL detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | Deleted in azoospermia-like protein; Deleted in azoospermia-like transcript variant 1; Deleted in azoospermia-like transcript variant 2; DAZL |
UniProt ID | A3DUJ0 |
Protein Refseq | The length of the protein is 295 amino acids long. The sequence is show below: MSAANPETPNSTISREASTQSSSATTSQGYVLPEGKIMPNTVFVGGIDVRMDETEIRSFFARYGSVKEVKIITDRTGVSKGYGFVSFYNDVDVQKIVESQINFHGKKLKLGPAIRKQNLCAYHVQPRPLVFNPPPPPQFQSVWSNPNAETYMQPPTMINPITQYVQAYPPYPSSPVQVITGYQLPVYNYQMPPQWPAGEQRSYVIPPAYTTINYHCNEVDTGADVLPSECSVHEATPSSGNGPQKKSVDRSIQTV. |
See other products for " Dazl "
MO-AB-11203Y | Mouse Anti-O. mykiss Dazl Antibody (MO-AB-11203Y) |
MO-AB-02867H | Mouse Anti-Frog dazl Antibody (MO-AB-02867H) |
MO-AB-33016H | Mouse Anti-Nile tilapia dazl Antibody (MO-AB-33016H) |
MO-AB-53925W | Mouse Anti-Marmoset DAZL Antibody (MO-AB-53925W) |
MO-AB-01550Y | Mouse Anti-Chicken DAZL Antibody (MO-AB-01550Y) |
MO-AB-37107W | Mouse Anti-Goat dazl Antibody (MO-AB-37107W) |
MO-AB-25300R | Mouse Anti-Pig DAZL Antibody (MO-AB-25300R) |
MO-AB-00379R | Mouse Anti-Medaka dazl Antibody (MO-AB-00379R) |
MO-AB-14917Y | Mouse Anti-Sheep DAZL Antibody (MO-AB-14917Y) |
CBMOAB-72955FYA | Mouse Anti-Zebrafish dazl Antibody (CBMOAB-72955FYA) |
For Research Use Only | Not For Clinical Use.
Online Inquiry