Mouse Anti-Cattle DIS3 Antibody (MO-AB-11455R)


Cat: MO-AB-11455R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCattle (Bos taurus)
CloneMO11455R
SpecificityThis antibody binds to Cattle DIS3.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionCatalytic component of the RNA exosome complex which has 3''->5'' exoribonuclease activity and participates in a multitude of cellular RNA processing and degradation events. In the nucleus, the RNA exosome complex is involved in proper maturation of stable RNA species such as rRNA, snRNA and snoRNA, in the elimination of RNA processing by-products and non-coding ''pervasive'' transcripts, such as antisense RNA species and cryptic unstable transcripts (CUTs), and of mRNAs with processing defects, thereby limiting or excluding their export to the cytoplasm. In the cytoplasm, the RNA exosome complex is involved in general mRNA turnover and in RNA surveillance pathways, preventing translation of aberrant mRNAs. The catalytic inactive RNA exosome core complex of 9 subunits (Exo-9) is proposed to play a pivotal role in the binding and presentation of RNA for ribonucleolysis, and to serve as a scaffold for the association with catalytic subunits and accessory proteins or complexes. DIS3 has both 3''-5'' exonuclease and endonuclease activities. The exonuclease activity of DIS3 is down-regulated upon association with Exo-9 possibly involving a conformational change in the catalytic domain and threading of the RNA substrate through the complex central channel. Structured substrates can be degraded if they have a 3'' single-stranded extension sufficiently long (such as 35 nt poly(A)) to span the proposed complex inner RNA-binding path and to reach the exonuclease site provided by DIS3. Plays a role in mitotic control.
Product OverviewMouse Anti-Cattle DIS3 Antibody is a mouse antibody against DIS3. It can be used for DIS3 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesDIS3 protein, Fragment; DIS3
UniProt IDQ3MHY3
Protein RefseqThe length of the protein is 628 amino acids long.
The sequence is show below: MLKSKTFLKKTRAGGVMKIVREHYLRDDIGCGASGCAVCDGAHEGPVLELQPLDRASSLCPQPHYLLPDTNVLLHQIDVLEDPAIRNVIVLQTVLQEVRNRSAPVYKRIRDMTNNQEKHFYTFTNEHHRETYVEQLQGENSNDRNDRAIRVAAKWYNEHLKNMSAENRLQVIFITNDRKNKEKAIEEGIPAFTCEEYIKSLTANPELIDRLACLSEEGNEIESGKTIFSEHLPLSKLQQGIKSGTYLQGTFRASR.
For Research Use Only | Not For Clinical Use.
Online Inquiry