Mouse Anti-Cattle DIS3 Antibody (MO-AB-11455R)
Cat: MO-AB-11455R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
Size: | |
Conjugate: | |
Inquiry |
- Product Details
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Cattle (Bos taurus) |
Clone | MO11455R |
Specificity | This antibody binds to Cattle DIS3. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | Catalytic component of the RNA exosome complex which has 3''->5'' exoribonuclease activity and participates in a multitude of cellular RNA processing and degradation events. In the nucleus, the RNA exosome complex is involved in proper maturation of stable RNA species such as rRNA, snRNA and snoRNA, in the elimination of RNA processing by-products and non-coding ''pervasive'' transcripts, such as antisense RNA species and cryptic unstable transcripts (CUTs), and of mRNAs with processing defects, thereby limiting or excluding their export to the cytoplasm. In the cytoplasm, the RNA exosome complex is involved in general mRNA turnover and in RNA surveillance pathways, preventing translation of aberrant mRNAs. The catalytic inactive RNA exosome core complex of 9 subunits (Exo-9) is proposed to play a pivotal role in the binding and presentation of RNA for ribonucleolysis, and to serve as a scaffold for the association with catalytic subunits and accessory proteins or complexes. DIS3 has both 3''-5'' exonuclease and endonuclease activities. The exonuclease activity of DIS3 is down-regulated upon association with Exo-9 possibly involving a conformational change in the catalytic domain and threading of the RNA substrate through the complex central channel. Structured substrates can be degraded if they have a 3'' single-stranded extension sufficiently long (such as 35 nt poly(A)) to span the proposed complex inner RNA-binding path and to reach the exonuclease site provided by DIS3. Plays a role in mitotic control. |
Product Overview | Mouse Anti-Cattle DIS3 Antibody is a mouse antibody against DIS3. It can be used for DIS3 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | DIS3 protein, Fragment; DIS3 |
UniProt ID | Q3MHY3 |
Protein Refseq | The length of the protein is 628 amino acids long. The sequence is show below: MLKSKTFLKKTRAGGVMKIVREHYLRDDIGCGASGCAVCDGAHEGPVLELQPLDRASSLCPQPHYLLPDTNVLLHQIDVLEDPAIRNVIVLQTVLQEVRNRSAPVYKRIRDMTNNQEKHFYTFTNEHHRETYVEQLQGENSNDRNDRAIRVAAKWYNEHLKNMSAENRLQVIFITNDRKNKEKAIEEGIPAFTCEEYIKSLTANPELIDRLACLSEEGNEIESGKTIFSEHLPLSKLQQGIKSGTYLQGTFRASR. |
See other products for " DIS3 "
MO-AB-44427W | Mouse Anti-Horse DIS3 Antibody (MO-AB-44427W) |
MO-AB-19916W | Mouse Anti-Chimpanzee DIS3 Antibody (MO-AB-19916W) |
CBMOAB-01030CR | Mouse Anti-Yeast DIS3 Antibody (CBMOAB-01030CR) |
MO-AB-54222W | Mouse Anti-Marmoset DIS3 Antibody (MO-AB-54222W) |
CBMOAB-73568FYA | Mouse Anti-Zebrafish dis3 Antibody (CBMOAB-73568FYA) |
CBMOAB-02733HCB | Mouse Anti-C. elegans DIS3 Antibody (CBMOAB-02733HCB) |
MO-AB-02995H | Mouse Anti-Frog dis3 Antibody (MO-AB-02995H) |
CBMOAB-40799FYA | Mouse Anti-Rhesus DIS3 Antibody (CBMOAB-40799FYA) |
CBMOAB-14901FYA | Mouse Anti-D. melanogaster Dis3 Antibody (CBMOAB-14901FYA) |
For Research Use Only | Not For Clinical Use.
Online Inquiry