Mouse Anti-Horse DIS3 Antibody (MO-AB-44427W)


Cat: MO-AB-44427W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityHorse (Equus caballus)
CloneMO44427W
SpecificityThis antibody binds to Horse DIS3.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionDIS3 (DIS3 Homolog, Exosome Endoribonuclease And 3'-5' Exoribonuclease) is a Protein Coding gene. Diseases associated with DIS3 include Combat Disorder and Acute Stress Disorder. Among its related pathways are CDK-mediated phosphorylation and removal of Cdc6 and Gene Expression. Gene Ontology (GO) annotations related to this gene include RNA binding and endonuclease activity. An important paralog of this gene is DIS3L.
Product OverviewMouse Anti-Horse DIS3 Antibody is a mouse antibody against DIS3. It can be used for DIS3 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesExosome complex exonuclease RRP44-like protein; DIS3
UniProt IDL7MRY9
Protein RefseqThe length of the protein is153 amino acids long.
The sequence is show below: DKHKLADLCKNLNFRHKMAQYAQRASVAFHTQLFFKSKGIVSEEAYILFVRKNAIVVLIPKYGLEGTVFFEEKDKPKPRLIYDDEIPSLKIEDTVFHIFDKVKAKIVLDSSNLQHQKIRMSLVEPQIPGISIPMDTSNMDINEPERKKKKLEK.
For Research Use Only | Not For Clinical Use.
Online Inquiry