Mouse Anti-Cattle EPC1 Antibody (MO-AB-12074R)


Cat: MO-AB-12074R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCattle (Bos taurus)
CloneMO12074R
SpecificityThis antibody binds to Cattle EPC1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a member of the polycomb group (PcG) family. The encoded protein is a component of the NuA4 histone acetyltransferase complex and can act as both a transcriptional activator and repressor. The encoded protein has been linked to apoptosis, DNA repair, skeletal muscle differentiation, gene silencing, and adult T-cell leukemia/lymphoma. Alternative splicing results in multiple transcript variants.
Product OverviewMouse Anti-Cattle EPC1 Antibody is a mouse antibody against EPC1. It can be used for EPC1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesEnhancer of polycomb homolog; EPC1
UniProt IDE1BB99
Protein RefseqThe length of the protein is 842 amino acids long.
The sequence is show below: MSKLSFRARALDASKPLPVFRCEDLPDLHEYASINRAVPQMPTGMEKEEESEHHLQRAISAQQVYGEKRDNMVIPVPEAESNIAYYESIYPGEFKMPKQLIHIQPFSLDAEQPDYDLDSEDEVFVNKLKKKMDICPLQFEEMIDRLEKGSGQQPVSLQEAKLLLKEDDELIREVYEYWIKKRKNCRGPSLIPSVKQEKRDGSSTNDPYVAFRRRTEKMQTRKNRKNDEASYEKMLKLRRDLSRAVTILEMIKRRE.
See other products for " EPC1 "
MO-AB-25685RMouse Anti-Pig EPC1 Antibody (MO-AB-25685R)
CBMOAB-28462FYCMouse Anti-Arabidopsis EPC1 Antibody (CBMOAB-28462FYC)
MO-AB-06470YMouse Anti-O. anatinus EPC1 Antibody (MO-AB-06470Y)
MO-AB-15194YMouse Anti-Sheep EPC1 Antibody (MO-AB-15194Y)
MO-AB-09101WMouse Anti-Cat EPC1 Antibody (MO-AB-09101W)
MO-AB-00458RMouse Anti-Medaka EPC1 Antibody (MO-AB-00458R)
MO-AB-03329HMouse Anti-Frog epc1 Antibody (MO-AB-03329H)
MO-AB-33076HMouse Anti-Nile tilapia EPC1 Antibody (MO-AB-33076H)
MO-AB-01769YMouse Anti-Chicken EPC1 Antibody (MO-AB-01769Y)
MO-AB-23191HMouse Anti-Mallard EPC1 Antibody (MO-AB-23191H)
For Research Use Only | Not For Clinical Use.
Online Inquiry