Mouse Anti-Frog epc1 Antibody (MO-AB-03329H)


Cat: MO-AB-03329H
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityFrog (Xenopus laevis)
CloneMO03329C
SpecificityThis antibody binds to Frog epc1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a member of the polycomb group (PcG) family. The encoded protein is a component of the NuA4 histone acetyltransferase complex and can act as both a transcriptional activator and repressor. The encoded protein has been linked to apoptosis, DNA repair, skeletal muscle differentiation, gene silencing, and adult T-cell leukemia/lymphoma. Alternative splicing results in multiple transcript variants.
Product OverviewThis product is a mouse antibody against epc1. It can be used for epc1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesEnhancer of polycomb homolog; epc1; LOC494670
UniProt IDQ640H8
Protein RefseqThe length of the protein is 114 amino acids long.
The sequence is show below: MSKLSFRARALDASKPLPVFRCEDLPDLHEYASINRAVPQMPTGMEKEEESVMLRFFSLYFYRLYPPSTRSLLCASLHKMAAMFLPDGNGDGAHTSPLVIPHSGWLVGLIRISL.
For Research Use Only | Not For Clinical Use.
Online Inquiry