Mouse Anti-Cattle FBL Antibody (MO-AB-12388R)


Cat: MO-AB-12388R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCattle (Bos taurus)
CloneMO12388R
SpecificityThis antibody binds to Cattle FBL.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene product is a component of a nucleolar small nuclear ribonucleoprotein (snRNP) particle thought to participate in the first step in processing preribosomal RNA. It is associated with the U3, U8, and U13 small nuclear RNAs and is located in the dense fibrillar component (DFC) of the nucleolus. The encoded protein contains an N-terminal repetitive domain that is rich in glycine and arginine residues, like fibrillarins in other species. Its central region resembles an RNA-binding domain and contains an RNP consensus sequence. Antisera from approximately 8% of humans with the autoimmune disease scleroderma recognize fibrillarin. [provided by RefSeq, Jul 2008]
Product OverviewMouse Anti-Cattle FBL Antibody is a mouse antibody against FBL. It can be used for FBL detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesFBL protein, Fragment; FBL
UniProt IDA6QLX2
Protein RefseqThe length of the protein is 354 amino acids long.
The sequence is show below: GRAPALLPTCVSFSRVEPGKPPIPEPSSSALAMKPGFSPRGGGFGGRGGFGDRGGRGGGRGGFGGGRGGFGGGRGRGGGGGGFRGRGRGGGGRGGGFQSGGNRGRGRGGKKGNPSGKNVMVEPHRHEGVFICRGKEDALVTKNLVPGESVYGEKRVSISEGDDKIEYRAWNPFRSKLAAAILGGVDQIHIKPGAKVLYLGAASGTTVSHVSDIVGPDGLVYAVEFSHRSGRDLINLAKKRTNIIPVIEDARHPHK.
For Research Use Only | Not For Clinical Use.
Online Inquiry