Mouse Anti-Zebrafish fbl Antibody (CBMOAB-76144FYA)


Cat: CBMOAB-76144FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio)
CloneMO76144FYA
SpecificityThis antibody binds to Zebrafish fbl.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene product is a component of a nucleolar small nuclear ribonucleoprotein (snRNP) particle thought to participate in the first step in processing preribosomal RNA. It is associated with the U3, U8, and U13 small nuclear RNAs and is located in the dense fibrillar component (DFC) of the nucleolus. The encoded protein contains an N-terminal repetitive domain that is rich in glycine and arginine residues, like fibrillarins in other species. Its central region resembles an RNA-binding domain and contains an RNP consensus sequence. Antisera from approximately 8% of humans with the autoimmune disease scleroderma recognize fibrillarin.
Product OverviewMouse Anti-Zebrafish fbl Antibody is a mouse antibody against fbl. It can be used for fbl detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesFibrillarin; fb
UniProt IDQ7ZTZ4
Protein RefseqThe length of the protein is 317 amino acids long.
The sequence is show below: MRPGFSPRGGGGRGGFGGRGRGGGDRGGRGGFRGGRGGFGGGFKSPGGEGGFRGRGGGRGTPRGRGGGRGGGRGGFRGGAKVTVEPHRHEGVFICRGKEDALVTKNMVIGESVYGEKRINVEEGETKIEYRAWNPFRSKLAAAILGGIDQIHIKPGVKVMYLGAASGTTVSHVSDIVGPEGLVYAVEFSHRSGRDLLNVAKKRTNIIPIIEDARHPHKYRMLVGMVDVIFADVAQPDQTRIVALNAHNFLKNGGHFVISIKANCIDSTAAPEAVFASEVKKMSAENMKPQEQLTLEPYERDHAVVVGIYRPPPKGKK.
See other products for " FBL "
MO-AB-03701WMouse Anti-Rhesus FBL Antibody (MO-AB-03701W)
CBMOAB-42628FYAMouse Anti-Rhesus FBL Antibody (CBMOAB-42628FYA)
MO-AB-19332WMouse Anti-Chimpanzee FBL Antibody (MO-AB-19332W)
MO-NAB-00265WMouse Anti-Yeast FBL Antibody (MO-NAB-00265W)
MO-AB-03501HMouse Anti-Frog fbl Antibody (MO-AB-03501H)
CBMOAB-16580FYAMouse Anti-D. melanogaster Fbl Antibody (CBMOAB-16580FYA)
MO-AB-12388RMouse Anti-Cattle FBL Antibody (MO-AB-12388R)
For Research Use Only | Not For Clinical Use.
Online Inquiry