Mouse Anti-Cattle FMO1 Antibody (MO-AB-12638R)


Cat: MO-AB-12638R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCattle (Bos taurus)
CloneMO12638R
SpecificityThis antibody binds to Cattle FMO1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationOther locations; Endoplasmic reticulum

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionMetabolic N-oxidation of the diet-derived amino-trimethylamine (TMA) is mediated by flavin-containing monooxygenase and is subject to an inherited FMO3 polymorphism in man resulting in a small subpopulation with reduced TMA N-oxidation capacity resulting in fish odor syndrome Trimethylaminuria. Three forms of the enzyme, FMO1 found in fetal liver, FMO2 found in adult liver, and FMO3 are encoded by genes clustered in the 1q23-q25 region. Flavin-containing monooxygenases are NADPH-dependent flavoenzymes that catalyzes the oxidation of soft nucleophilic heteroatom centers in drugs, pesticides, and xenobiotics. Several transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Sep 2013]
Product OverviewMouse Anti-Cattle FMO1 Antibody is a mouse antibody against FMO1. It can be used for FMO1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesDimethylaniline monooxygenase [N-oxide-forming]; EC 1.14.13.8; FMO1
UniProt IDG5E5R0
Protein RefseqThe length of the protein is 532 amino acids long.
The sequence is show below: MAKRVAIVGAGATGLASIKCCLEEGLKPTCFERSDDLGGLWRFTEHVEEGRASLYKSVVSNSCKEMSCYPDFPFPEDYPNYVPNSQFLDYLKMYANRFNLLECIQFKTKVCSVRKRPDFTATGQWEVVTLCEGKQESAIFDAVMVCTGFLTNPNLPLDSFPGINNFKGQYFHSREYKHPDIFRDKSVLVIGMGNSGTDIAVEASHLAKKVFLSTTGGAWVISRVFDSGYPWDMVFMTRFQNTFRNSLPTPIVNWL.
For Research Use Only | Not For Clinical Use.
Online Inquiry