Mouse Anti-Cattle FUT3 Antibody (MO-AB-12762R)


Cat: MO-AB-12762R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCattle (Bos taurus)
CloneMO12762R
SpecificityThis antibody binds to Cattle FUT3.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationGolgi apparatus; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe Lewis histo-blood group system comprises a set of fucosylated glycosphingolipids that are synthesized by exocrine epithelial cells and circulate in body fluids. The glycosphingolipids function in embryogenesis, tissue differentiation, tumor metastasis, inflammation, and bacterial adhesion. They are secondarily absorbed to red blood cells giving rise to their Lewis phenotype. This gene is a member of the fucosyltransferase family, which catalyzes the addition of fucose to precursor polysaccharides in the last step of Lewis antigen biosynthesis. It encodes an enzyme with alpha(1,3)-fucosyltransferase and alpha(1,4)-fucosyltransferase activities. Mutations in this gene are responsible for the majority of Lewis antigen-negative phenotypes. Multiple alternatively spliced variants, encoding the same protein, have been found for this gene.
Product OverviewMouse Anti-Cattle FUT3 Antibody is a mouse antibody against FUT3. It can be used for FUT3 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesGalactoside 3(4)-L-fucosyltransferase; EC 2.4.1.65; Blood group Lewis alpha-4-fucosyltransferase; Lewis FT; FUTB; Fucosyltransferase 3; Fucosyltransferase III; FucT-III; FUT3
UniProt IDQ11126
Protein RefseqThe length of the protein is 365 amino acids long.
The sequence is show below: MYPPGCAKVKCSWHHCLPGLLLQLLLALCFFSYLRMSQEKPKPKPMWVSELGAPSQATEGSSAHLPLRVLLWTWPFNQPVALSRCSELWPGTADCQLTVNRSEYPQADAVLVHHREVSHRPQMQLPPSPRPPGQRWVWFSMESPSNCLKLKDLDGYFNLTMSYRRDSDIFMPYGWLEPWPSQPVETLLNISAKTKLVAWVVSNWNTDSIRVQYYKLLKPHLQVDVYGRFHTPLPHALMAKQLSQYKFYLAFENSL.
For Research Use Only | Not For Clinical Use.
Online Inquiry