Mouse Anti-Cattle GAD2 Antibody (MO-AB-12836R)
Cat: MO-AB-12836R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
| Size: | |
| Conjugate: | |
| Inquiry |
- Product Details
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Cattle (Bos taurus) |
| Clone | MO12836R |
| Specificity | This antibody binds to Cattle GAD2. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | This gene encodes one of several forms of glutamic acid decarboxylase, identified as a major autoantigen in insulin-dependent diabetes. The enzyme encoded is responsible for catalyzing the production of gamma-aminobutyric acid from L-glutamic acid. A pathogenic role for this enzyme has been identified in the human pancreas since it has been identified as an autoantibody and an autoreactive T cell target in insulin-dependent diabetes. This gene may also play a role in the stiff man syndrome. Alternative splicing results in multiple transcript variants that encode the same protein. [provided by RefSeq, Oct 2008] |
| Product Overview | Mouse Anti-Cattle GAD2 Antibody is a mouse antibody against GAD2. It can be used for GAD2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | Glutamate decarboxylase, Fragment; GAD2 |
| UniProt ID | B6A7R2 |
| Protein Refseq | The length of the protein is 31 amino acids long. The sequence is show below: CLELAEYLYNIIKNREGYEMVFDGKPQHTNV. |
See other products for " GAD2 "
| MO-DKB-00628W | Rabbit Anti-GAD2 Antibody (MO-DKB-00628W) |
| CBMOAB-04223HCB | Mouse Anti-C. elegans GAD2 Antibody (CBMOAB-04223HCB) |
| MO-AB-55796W | Mouse Anti-Marmoset GAD2 Antibody (MO-AB-55796W) |
| MO-AB-34513H | Mouse Anti-Tomato GAD2 Antibody (MO-AB-34513H) |
| CBMOAB-77445FYA | Mouse Anti-Zebrafish gad2 Antibody (CBMOAB-77445FYA) |
| CBMOAB-33668FYC | Mouse Anti-Arabidopsis GAD2 Antibody (CBMOAB-33668FYC) |
| MO-AB-30870W | Mouse Anti-Dog GAD2 Antibody (MO-AB-30870W) |
For Research Use Only | Not For Clinical Use.
Online Inquiry