Mouse Anti-Cattle GATA3 Antibody (MO-AB-12912R)


Cat: MO-AB-12912R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCattle (Bos taurus)
CloneMO12912R
SpecificityThis antibody binds to Cattle GATA3.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a protein which belongs to the GATA family of transcription factors. The protein contains two GATA-type zinc fingers and is an important regulator of T-cell development and plays an important role in endothelial cell biology. Defects in this gene are the cause of hypoparathyroidism with sensorineural deafness and renal dysplasia.
Product OverviewMouse Anti-Cattle GATA3 Antibody is a mouse antibody against GATA3. It can be used for GATA3 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesTrans-acting T-cell-specific transcription factor GATA-3; GATA-binding factor 3; GATA3
UniProt IDQ08DV0
Protein RefseqThe length of the protein is 443 amino acids long.
The sequence is show below: MEVTADQPRWVSHHHPAVLNGQHPDTHHPGLGHSYMDPAQYPLPEEVDVLFNIDGQGNHVPSYYGNSVRATVQRYPPTHHGSQVCRPPLLHGSLPWLDGGKALGSHHTASPWNLSPFSKTSIHHGSPGPLSVYPPASSSSLSAGHSSPHLFTFPPTPPKDVSPDPSLSTPGSAGSGRQDEKECIKYQVPLPDSMKLESAHPRGSMATLGGAAASAHHPITTYPPYVPEYSSGLFPPSSLLGGSPTGFGCKSRPKA.
For Research Use Only | Not For Clinical Use.
Online Inquiry