Mouse Anti-Chimpanzee GATA3 Antibody (MO-AB-10251W)
Cat: MO-AB-10251W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
Size: | |
Conjugate: | |
Inquiry |
- Product Details
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Chimpanzee (Pan troglodytes) |
Clone | MO10251W |
Specificity | This antibody binds to Chimpanzee GATA3. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Cellular Localization | Nucleus |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | This gene encodes a protein which belongs to the GATA family of transcription factors. The protein contains two GATA-type zinc fingers and is an important regulator of T-cell development and plays an important role in endothelial cell biology. Defects in this gene are the cause of hypoparathyroidism with sensorineural deafness and renal dysplasia. |
Product Overview | Mouse Anti-Chimpanzee GATA3 Antibody is a mouse antibody against GATA3. It can be used for GATA3 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | GATA3 |
UniProt ID | A2T788 |
Protein Refseq | The length of the protein is 35 amino acids long. The sequence is show below: LWRRDGTGHYLCNACGLYHKMNGQNRPLIKPKRRL. |
See other products for " gata3 "
MO-AB-03821H | Mouse Anti-Frog gata3 Antibody (MO-AB-03821H) |
MO-AB-00564R | Mouse Anti-Medaka gata3 Antibody (MO-AB-00564R) |
MO-DKB-03675W | Rabbit Anti-GATA3 Antibody (Cat MO-DKB-03675W) |
CBMOAB-33748FYC | Mouse Anti-Arabidopsis GATA3 Antibody (CBMOAB-33748FYC) |
MO-AB-55875W | Mouse Anti-Marmoset GATA3 Antibody (MO-AB-55875W) |
CBMOAB-77582FYA | Mouse Anti-Zebrafish gata3 Antibody (CBMOAB-77582FYA) |
MO-AB-12912R | Mouse Anti-Cattle GATA3 Antibody (MO-AB-12912R) |
MO-AB-09511W | Mouse Anti-Cat GATA3 Antibody (MO-AB-09511W) |
MO-AB-15378Y | Mouse Anti-Sheep GATA3 Antibody (MO-AB-15378Y) |
MO-AB-11465Y | Mouse Anti-O. mykiss Gata3 Antibody (MO-AB-11465Y) |
For Research Use Only | Not For Clinical Use.
Online Inquiry