Mouse Anti-Cattle GLE1 Antibody (MO-AB-13101R)


Cat: MO-AB-13101R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCattle (Bos taurus)
CloneMO13101R
SpecificityThis antibody binds to Cattle GLE1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationCytosol; Cytoskeleton; Nucleus; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a predicted 75-kDa polypeptide with high sequence and structure homology to yeast Gle1p, which is nuclear protein with a leucine-rich nuclear export sequence essential for poly(A)+RNA export. Inhibition of human GLE1L by microinjection of antibodies against GLE1L in HeLa cells resulted in inhibition of poly(A)+RNA export. Immunoflourescence studies show that GLE1L is localized at the nuclear pore complexes. This localization suggests that GLE1L may act at a terminal step in the export of mature RNA messages to the cytoplasm. Two alternatively spliced transcript variants encoding different isoforms have been found for this gene.
Product OverviewMouse Anti-Cattle GLE1 Antibody is a mouse antibody against GLE1. It can be used for GLE1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesNucleoporin GLE1; GLE1-like protein; GLE1; GLE1L
UniProt IDQ3ZBK7
Protein RefseqThe length of the protein is 698 amino acids long.
The sequence is show below: MPSEGRCWETLQALRSCDKGRLCYDRDWLLRGEDVLQECMSLPKLSSYSGWVVDHVLPHIQKNAPPSETSASSVSTSALDQPSSVPRSPLRNPAYSPVSSATSNGTKDKYESPHTEPVVLQSPRGMKVEGCIRMYELVHRMKGAEGLRQWQEEQEKKVRALSEMASEQLKRFDERKELKHHKEFQDLREVMEKSSREALGQQEKLKAEHRHRAKILNLKLREAEQQRLKQEEQERLRKEEGQARLRGLYALQEEV.
See other products for " GLE1 "
CBMOAB-01515CRMouse Anti-Yeast GLE1 Antibody (CBMOAB-01515CR)
MO-DKB-02145WRabbit Anti-GLE1 Antibody (MO-DKB-02145W)
MO-AB-56052WMouse Anti-Marmoset GLE1 Antibody (MO-AB-56052W)
CBMOAB-34061FYCMouse Anti-Arabidopsis GLE1 Antibody (CBMOAB-34061FYC)
CBMOAB-17686FYAMouse Anti-D. melanogaster Gle1 Antibody (CBMOAB-17686FYA)
MO-AB-21875WMouse Anti-Chimpanzee GLE1 Antibody (MO-AB-21875W)
CBMOAB-77966FYAMouse Anti-Zebrafish gle1 Antibody (CBMOAB-77966FYA)
MO-DKB-02142WRabbit Anti-GLE1 Antibody (MO-DKB-02142W)
For Research Use Only | Not For Clinical Use.
Online Inquiry