Mouse Anti-Cattle HDAC4 Antibody (MO-AB-13594R)


Cat: MO-AB-13594R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCattle (Bos taurus)
CloneMO13594R
SpecificityThis antibody binds to Cattle HDAC4.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationOther locations; Cytosol; Nucleus; Cytoskeleton

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionHistones play a critical role in transcriptional regulation, cell cycle progression, and developmental events. Histone acetylation/deacetylation alters chromosome structure and affects transcription factor access to DNA. The protein encoded by this gene belongs to class II of the histone deacetylase/acuc/apha family. It possesses histone deacetylase activity and represses transcription when tethered to a promoter. This protein does not bind DNA directly, but through transcription factors MEF2C and MEF2D. It seems to interact in a multiprotein complex with RbAp48 and HDAC3. [provided by RefSeq, Jul 2008]
Product OverviewMouse Anti-Cattle HDAC4 Antibody is a mouse antibody against HDAC4. It can be used for HDAC4 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesHistone deacetylase; EC 3.5.1.98; HDAC4
UniProt IDF1MYR0
Protein RefseqThe length of the protein is 1084 amino acids long.
The sequence is show below: MSSQSHPDGLSGRDQPVELLNPARVNHMPSTVDVASALPLPVAPPGVPMDLRLDHQFPLPVAEPGLREQQLQQELLALKQKQQLQRQILIAEFQRQHEQLSRQHEAQLHEHIKQQQELLAMKHQQELLEHQRKLERHRQEQELEKQHREQKLQQLKNKEKGKESAVASTEVKMKLQEFVLNKKKALAHRNLNHCMSSDPRYWYGKTQHSSLDQSSPPQSGASASYNHPVLGMYDAKDDFPLRKTASEPNLKLRSR.
For Research Use Only | Not For Clinical Use.
Online Inquiry