Mouse Anti-Cattle ITGA2B Antibody (MO-AB-14316R)


Cat: MO-AB-14316R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCattle (Bos taurus)
CloneMO14316R
SpecificityThis antibody binds to Cattle ITGA2B.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationPlasma membrane; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a member of the integrin alpha chain protein family. The encoded preproprotein is proteolytically processed to generate light and heavy chains, which are disulfide-bonded to form subunits of the alpha-IIb/beta-3 integrin cell adhesion receptor. This receptor plays a crucial role in the blood coagulation system by mediating platelet aggregation. Mutations in this gene have been associated with platelet bleeding disorders characterized by failure of platelet aggregation, including Glanzmann''s thrombocytopenia. [Provided by RefSeq, January 2016]
Product OverviewMouse Anti-Cattle ITGA2B Antibody is a mouse antibody against ITGA2B. It can be used for ITGA2B detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesITGA2B protein; ITGA2B
UniProt IDA6QLB3
Protein RefseqThe length of the protein is 1034 amino acids long.
The sequence is show below: MARALCLLRALWLLEWVQLLLGPGAMPPTWALNLDSVQFTVYTGPNGSHFGFSLDFYKNSNGSVYVVVGAPRTLGHSEEETGGVFLCPWKAEGGQCISLPFDLYDETRSIGTQTFQTFKAGQGLGASVVSWRDSIVACAPWQHWNVLDRNEEEAQKTPVGGCFVAQLQNGDRTEYSPCRDNKMSQFYERNHFRDDRRYCEAGFSSVVTQAGELVLGAPGGYYFVGLLARAPIADIISSYRPSTLLWHVPTQFTYD.
See other products for " ITGA2B "
CBMOAB-00155FYAMouse Anti-Dog ITGA2B Antibody (CBMOAB-00155FYA)
CBMOAB-00055FYAMouse Anti-Cattle ITGA2B Antibody (CBMOAB-00055FYA)
CBMOAB-45621FYAMouse Anti-Rhesus ITGA2B Antibody (CBMOAB-45621FYA)
CBMOAB-81228FYAMouse Anti-Zebrafish itga2b Antibody (CBMOAB-81228FYA)
CBMOAB-00137FYAMouse Anti-Dog ITGA2B Antibody (CBMOAB-00137FYA)
MOFY-1222-FY50Rabbit Anti-itga2b Antibody (MOFY-1222-FY50)
For Research Use Only | Not For Clinical Use.
Online Inquiry