Mouse Anti-Rhesus ITGA2B Antibody (CBMOAB-45621FYA)


Cat: CBMOAB-45621FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta)
CloneMO45621FYA
SpecificityThis antibody binds to Rhesus ITGA2B.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationPlasma Membrane; Extracellular region or secreted; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a member of the integrin alpha chain family of proteins. The encoded preproprotein is proteolytically processed to generate light and heavy chains that associate through disulfide linkages to form a subunit of the alpha-IIb/beta-3 integrin cell adhesion receptor. This receptor plays a crucial role in the blood coagulation system, by mediating platelet aggregation. Mutations in this gene are associated with platelet-type bleeding disorders, which are characterized by a failure of platelet aggregation, including Glanzmann thrombasthenia.
Product OverviewMouse Anti-Rhesus ITGA2B Antibody is a mouse antibody against ITGA2B. It can be used for ITGA2B detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesITGA2B
UniProt IDF7E7I7
Protein RefseqThe length of the protein is 1045 amino acids long.
The sequence is show below: MARALCPLQALWLLEWVLLLLGPCAAPPAWALNLDPVHLTFYAGPNGSHFGFSLDFHKDSHGRVAIVVGAPRTLGPSQEETGSVFLCPWRAEGGQCPSLLFDLRDETRNVGSQTLQTFKARQGLGASVVSWSDVIVACAPWQHWNVLEKTEEAEKTPVGSCFLAQPESGRRAEYSPCRGNTLSRIYVENNFSSDKRYCEAGFSSVVTQAGELVLGAPGGYYFLGLLAQAPIADIFSSYRPGILLWHVSSQSLSFDSSNPEYFDGYWGYSVAVGEFDGDLNTTRNPLRAGYVVGAPTWSWTLGAVEILGSYFQRLHRLHGEQMASYFGHSVAVTDVNGDGRHDLLVGAPLYMESRADRKLAEVGRVYLFLQPRGPHTLGAPSLLLTGTQLYGRFGSAIAPLGDLDQDGYNDIAVAAPYGGPSGRGQVLVFLGQSEGLSSRPSQVLDSPFPTGSAFGFSLRGAVDIDDNGYPDLIVGAYGANQVAVYRAQPVVKASVQLLVQDSLNPAVKSCVLPQTKTPVSCFKIQMCVGATGHNIPQKLSLNAELQLDRQKPRQGRRVLLLGSQQAGTTLNLDLGGKHSPICHTTMAFLRDEAEFRDKLSPIVLSLNVSLPPTEAGMAPAVVLHGDTHVQEQTRIVLDCGEDDVCVPQLQLTASVTGSPLLVGADNVLELQMDTANEGEGAYEAELAVHLPQGAHYMRARSNVEGFERLICNQKKENETRVVLCELGNPMKKNTQIGIAMLVSVGNLEEAGESVSFQLQIRSKNSQNPNSKIVLLDVPVRAEAQVELRGNSFPASLVVAAEEGDREQNSLDSRGPKVEHTYELHNNGPGTVNGLHLSIHLPGQSQHSDLLYILDIQPQGGLQCFPQPPVNPLKVDWGLPTPSPSPVHPAHHKRDRRQIFLPEPEQPSRLQDPVLVSCDSAPCTVVQCDLQEMARGQRAMVTVLAFLWLPSLHQRPLDQFVLQSQAWFNVSSLPYAVPPLSLPRGEAQVRTQLLRALEERAIPIWWVLVGVLGGLLLLTILVLAMWKVGFFKRNRPPLEEDDEEGE.
For Research Use Only | Not For Clinical Use.
Online Inquiry