Mouse Anti-Cattle MCM4 Antibody (MO-AB-15459R)


Cat: MO-AB-15459R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCattle (Bos taurus)
CloneMO15459R
SpecificityThis antibody binds to Cattle MCM4.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe protein encoded by this gene is one of the highly conserved mini-chromosome maintenance proteins (MCM) that are essential for the initiation of eukaryotic genome replication. The hexameric protein complex formed by MCM proteins is a key component of the pre-replication complex (pre_RC) and may be involved in the formation of replication forks and in the recruitment of other DNA replication related proteins. The MCM complex consisting of this protein and MCM2, 6 and 7 proteins possesses DNA helicase activity, and may act as a DNA unwinding enzyme. The phosphorylation of this protein by CDC2 kinase reduces the DNA helicase activity and chromatin binding of the MCM complex. This gene is mapped to a region on the chromosome 8 head-to-head next to the PRKDC/DNA-PK, a DNA-activated protein kinase involved in the repair of DNA double-strand breaks. Alternatively spliced transcript variants encoding the same protein have been reported. [provided by RefSeq, Jul 2008]
Product OverviewMouse Anti-Cattle MCM4 Antibody is a mouse antibody against MCM4. It can be used for MCM4 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesMinichromosome maintenance complex component 4; MCM4
UniProt IDQ148N1
Protein RefseqThe length of the protein is 836 amino acids long.
The sequence is show below: MSSPASTPSRRGSRRAAPAQPRQDPLSSGEPQPLPSSPGAEPRTPSRAPPAAVPLDLDMSSPLTYGTPSSRVEGTPRSGVRGTPVRQRPDLGSARKGLQVDLHSDGPAAEDTVASEQSLGQKLVIWGTDVNVATCKENFQRFLQRFIDPLAKEEENVGIDITEPLYMQRLEEINVTGEPFLNVNCEHIKSFDTNLYRQLICYPQEVIPTFDMAVNEIFFDRYPDSILEHQIQVRPFNALKTKNMRNLNPEDIDQL.
For Research Use Only | Not For Clinical Use.
Online Inquiry