Mouse Anti-Cattle MCM4 Antibody (MO-AB-15459R)
Cat: MO-AB-15459R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
Size: | |
Conjugate: | |
Inquiry |
- Product Details
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Cattle (Bos taurus) |
Clone | MO15459R |
Specificity | This antibody binds to Cattle MCM4. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Cellular Localization | Nucleus; Other locations |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | The protein encoded by this gene is one of the highly conserved mini-chromosome maintenance proteins (MCM) that are essential for the initiation of eukaryotic genome replication. The hexameric protein complex formed by MCM proteins is a key component of the pre-replication complex (pre_RC) and may be involved in the formation of replication forks and in the recruitment of other DNA replication related proteins. The MCM complex consisting of this protein and MCM2, 6 and 7 proteins possesses DNA helicase activity, and may act as a DNA unwinding enzyme. The phosphorylation of this protein by CDC2 kinase reduces the DNA helicase activity and chromatin binding of the MCM complex. This gene is mapped to a region on the chromosome 8 head-to-head next to the PRKDC/DNA-PK, a DNA-activated protein kinase involved in the repair of DNA double-strand breaks. Alternatively spliced transcript variants encoding the same protein have been reported. [provided by RefSeq, Jul 2008] |
Product Overview | Mouse Anti-Cattle MCM4 Antibody is a mouse antibody against MCM4. It can be used for MCM4 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | Minichromosome maintenance complex component 4; MCM4 |
UniProt ID | Q148N1 |
Protein Refseq | The length of the protein is 836 amino acids long. The sequence is show below: MSSPASTPSRRGSRRAAPAQPRQDPLSSGEPQPLPSSPGAEPRTPSRAPPAAVPLDLDMSSPLTYGTPSSRVEGTPRSGVRGTPVRQRPDLGSARKGLQVDLHSDGPAAEDTVASEQSLGQKLVIWGTDVNVATCKENFQRFLQRFIDPLAKEEENVGIDITEPLYMQRLEEINVTGEPFLNVNCEHIKSFDTNLYRQLICYPQEVIPTFDMAVNEIFFDRYPDSILEHQIQVRPFNALKTKNMRNLNPEDIDQL. |
See other products for " Mcm4 "
MO-AB-05079H | Mouse Anti-Frog Mcm4 Antibody (MO-AB-05079H) |
MOFY-0922-FY15 | Mouse Anti-Mcm4 Antibody, IgG2b kappa (MOFY-0922-FY15) |
MO-AB-02869Y | Mouse Anti-Chicken Mcm4 Antibody (MO-AB-02869Y) |
CBMOAB-86305FYA | Mouse Anti-Zebrafish mcm4 Antibody (CBMOAB-86305FYA) |
CBMOAB-06462HCB | Mouse Anti-C. elegans MCM4 Antibody (CBMOAB-06462HCB) |
MOFY-0922-FY14 | Mouse Anti-Mcm4 Antibody, IgG2a kappa (MOFY-0922-FY14) |
MO-AB-13581H | Mouse Anti-Malaria parasite mcm4 Antibody (MO-AB-13581H) |
MO-AB-58863W | Mouse Anti-Marmoset MCM4 Antibody (MO-AB-58863W) |
MO-AB-24718W | Mouse Anti-Chimpanzee MCM4 Antibody (MO-AB-24718W) |
CBMOAB-34621FYB | Mouse Anti-Rice MCM4 Antibody (CBMOAB-34621FYB) |
For Research Use Only | Not For Clinical Use.
Online Inquiry