Mouse Anti-Cattle MCM5 Antibody (MO-AB-15461R)


Cat: MO-AB-15461R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCattle (Bos taurus)
CloneMO15461R
SpecificityThis antibody binds to Cattle MCM5.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationOther locations; Nucleus; Cytosol

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe protein encoded by this gene is structurally very similar to the CDC46 protein from S. cerevisiae, a protein involved in the initiation of DNA replication. The encoded protein is a member of the MCM family of chromatin-binding proteins and can interact with at least two other members of this family. The encoded protein is upregulated in the transition from the G0 to G1 / S phase of the cell cycle and may actively participate in cell cycle regulation.
Product OverviewMouse Anti-Cattle MCM5 Antibody is a mouse antibody against MCM5. It can be used for MCM5 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesDNA replication licensing factor MCM5; EC 3.6.4.12; MCM5
UniProt IDQ0V8B7
Protein RefseqThe length of the protein is 734 amino acids long.
The sequence is show below: MSGFDDPGIFYSDSFGGDNAADEGQARKSQLQRRFKEFLRQYRVGTDRTGFTFKYRDELKRHYNLGEYWIEVEMEDLASFDEELADYLYKQPAEHLQLLEEAAKEVADEVTRPRPAGDEVLQDIQVMLKSDASPSSIRSLKSDTMSHLVKIPGIVIAASGVRAKATRISIQCRSCHSTLTNIAMRPGLDGYALPRKCNTDQAGRPKCPLDPYFIMPDKCKCVDFQTLKLQELPDAVPHGEMPRHMQLYCDRYLCD.
For Research Use Only | Not For Clinical Use.
Online Inquiry