Mouse Anti-Cattle MCPH1 Antibody (MO-AB-15469R)


Cat: MO-AB-15469R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCattle (Bos taurus)
CloneMO15469R
SpecificityThis antibody binds to Cattle MCPH1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a DNA damage response protein. The encoded protein may play a role in G2/M checkpoint arrest via maintenance of inhibitory phosphorylation of cyclin-dependent kinase 1. Mutations in this gene have been associated with primary autosomal recessive microcephaly 1 and premature chromosome condensation syndrome. Alternatively spliced transcript variants have been described.
Product OverviewMouse Anti-Cattle MCPH1 Antibody is a mouse antibody against MCPH1. It can be used for MCPH1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesMCPH1 protein; MCPH1
UniProt IDA5PKI9
Protein RefseqThe length of the protein is 838 amino acids long.
The sequence is show below: MAAPGSLGGPVLKDVVAYVEVWSANGTENYSKTFRNQLVDMGAKVSKTFNKQVTHVVFKDGYQSTWEKAQKRGVKLVSVLWVDKCRVAGVHIDESLFPAANTNQHLPSLLKKKRKCMQPKDFIPRTPENDKRLQRKFEKMAKELQQQKTTLGTNVPVLSFESNGSLVYSPTGKVCRGHHSAMKKRLQEMKEKRENLSPTSYQMIEQSDDNTVNLLHEASLNLSHDTLCSDNSLAGGLPVSADDLCGGSASGTQEG.
See other products for " Mcph1 "
MO-AB-16122YMouse Anti-Sheep Mcph1 Antibody (MO-AB-16122Y)
MO-AB-04354WMouse Anti-Rhesus MCPH1 Antibody (MO-AB-04354W)
CBMOAB-51011FYAMouse Anti-Rhesus MCPH1 Antibody (CBMOAB-51011FYA)
MO-AB-27120WMouse Anti-Chimpanzee Mcph1 Antibody (MO-AB-27120W)
MO-AB-02871YMouse Anti-Chicken MCPH1 Antibody (MO-AB-02871Y)
MO-AB-05085HMouse Anti-Frog mcph1 Antibody (MO-AB-05085H)
MO-AB-10892WMouse Anti-Chimpanzee MCPH1 Antibody (MO-AB-10892W)
CBMOAB-23528FYAMouse Anti-D. melanogaster Mcph1 Antibody (CBMOAB-23528FYA)
CBMOAB-86337FYAMouse Anti-Zebrafish mcph1 Antibody (CBMOAB-86337FYA)
MO-AB-58869WMouse Anti-Marmoset MCPH1 Antibody (MO-AB-58869W)
For Research Use Only | Not For Clinical Use.
Online Inquiry