Mouse Anti-Chimpanzee Mcph1 Antibody (MO-AB-27120W)
Cat: MO-AB-27120W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
Size: | |
Conjugate: | |
Inquiry |
- Product Details
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Chimpanzee (Pan troglodytes) |
Clone | MO27120W |
Specificity | This antibody binds to Chimpanzee Mcph1. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | This gene encodes a DNA damage response protein. The encoded protein may play a role in G2/M checkpoint arrest via maintenance of inhibitory phosphorylation of cyclin-dependent kinase 1. Mutations in this gene have been associated with primary autosomal recessive microcephaly 1 and premature chromosome condensation syndrome. Alternatively spliced transcript variants have been described. |
Product Overview | Mouse Anti-Chimpanzee Mcph1 Antibody is a mouse antibody against Mcph1. It can be used for Mcph1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | Microcephalin; Mcph1 |
UniProt ID | Q6RBL8 |
Protein Refseq | The length of the protein is 39 amino acids long. The sequence is show below: VSKTFNKQVTHVIFKDGYQSTWDKAQKRGVKLVSVLWVE. |
See other products for " mcph1 "
MO-AB-05085H | Mouse Anti-Frog mcph1 Antibody (MO-AB-05085H) |
MO-AB-02871Y | Mouse Anti-Chicken MCPH1 Antibody (MO-AB-02871Y) |
MO-AB-58869W | Mouse Anti-Marmoset MCPH1 Antibody (MO-AB-58869W) |
MO-AB-15469R | Mouse Anti-Cattle MCPH1 Antibody (MO-AB-15469R) |
CBMOAB-23528FYA | Mouse Anti-D. melanogaster Mcph1 Antibody (CBMOAB-23528FYA) |
MO-AB-04354W | Mouse Anti-Rhesus MCPH1 Antibody (MO-AB-04354W) |
CBMOAB-86337FYA | Mouse Anti-Zebrafish mcph1 Antibody (CBMOAB-86337FYA) |
MO-AB-10892W | Mouse Anti-Chimpanzee MCPH1 Antibody (MO-AB-10892W) |
CBMOAB-51011FYA | Mouse Anti-Rhesus MCPH1 Antibody (CBMOAB-51011FYA) |
MO-AB-16122Y | Mouse Anti-Sheep Mcph1 Antibody (MO-AB-16122Y) |
For Research Use Only | Not For Clinical Use.
Online Inquiry