Mouse Anti-Cattle MOCS1 Antibody (MO-AB-15901R)


Cat: MO-AB-15901R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCattle (Bos taurus)
CloneMO15901R
SpecificityThis antibody binds to Cattle MOCS1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionMolybdenum cofactor biosynthesis is a conserved pathway leading to the biological activation of molybdenum. The protein encoded by this gene is involved in this pathway. This gene was originally thought to produce a bicistronic mRNA with the potential to produce two proteins (MOCS1A and MOCS1B) from adjacent open reading frames. However, only the first open reading frame (MOCS1A) has been found to encode a protein from the putative bicistronic mRNA, whereas additional splice variants are likely to produce a fusion between the two open reading frames. This gene is defective in patients with molybdenum cofactor deficiency, type A. A related pseudogene has been identified on chromosome 16.
Product OverviewMouse Anti-Cattle MOCS1 Antibody is a mouse antibody against MOCS1. It can be used for MOCS1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesMolybdenum cofactor biosynthesis protein 1; Molybdenum cofactor biosynthesis protein C; Molybdenum cofactor biosynthesis protein A; EC 4.1.99.18; MOCS1
UniProt IDQ1JQD7
Protein RefseqThe length of the protein is 633 amino acids long.
The sequence is show below: MAAQPVSRVVRRVLRAGVRSCSSGAPVTQPCPGEPVVEVLSRPRPFLGEHAAPFSAFLTDSFGRHHSYLRISLTERCNLRCQYCMPEEGVPLTPKADLLTTEEILTLARLFVKEGVDKIRLTGGEPLIRPDVVDIVAQLRQLEGLRTIGITTNGINLARLLPQLQKAGLSAINISLDTLVPAKFEFIVRRKGFHKVMEGIHKAIELGYSPVKVNCVVMRGLNEDELLDFVALTEGLPLDVRFIEYMPFDGNKWNF.
For Research Use Only | Not For Clinical Use.
Online Inquiry