Mouse Anti-Frog mocs1 Antibody (MO-AB-05253H)


Cat: MO-AB-05253H
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityFrog (Xenopus laevis)
CloneMO05253C
SpecificityThis antibody binds to Frog mocs1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionMolybdenum cofactor biosynthesis is a conserved pathway leading to the biological activation of molybdenum. The protein encoded by this gene is involved in this pathway. This gene was originally thought to produce a bicistronic mRNA with the potential to produce two proteins (MOCS1A and MOCS1B) from adjacent open reading frames. However, only the first open reading frame (MOCS1A) has been found to encode a protein from the putative bicistronic mRNA, whereas additional splice variants are likely to produce a fusion between the two open reading frames. This gene is defective in patients with molybdenum cofactor deficiency, type A. A related pseudogene has been identified on chromosome 16.
Product OverviewThis product is a mouse antibody against mocs1. It can be used for mocs1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesMGC84142 protein; mocs1; MGC84142
UniProt IDQ6GLX5
Protein RefseqThe length of the protein is 389 amino acids long.
The sequence is show below: MALPRGRLCALLRGRLGRNGPRGTNTRSCASGVPALELTAPAQGVSVTERKRFMKEHPVPFSAFLTDSFGRQHNYLRISVTEKCNLRCQYCMPEEGVKLTPKSELLTTQEIVTLAKLFVREGVDKIRLTGGEPLIRPDVVDIVAQLRKLEGLKTIALTTNGINLTRQLPKLKDAGLDVLNISLDTLVPPKFEFIVRRKGFHKVMEGINKAIDLGYNPVKVNCVVMRGLNEDELLDFVELTEKQPLEVRFIEYMPFDGNKWNFKKMVSYQEMLDTIRQRWPELETLPAEASSTSKNYKVPHFEGQIGFITSMSEHFCGSCNRLRLTADGNLKVCLFGNSEVSLRDCLRSEVSEEELIQIIGAAVGRKKKQHAGMFNISQMKNRPMILIGG.
For Research Use Only | Not For Clinical Use.
Online Inquiry