Mouse Anti-Cattle MOG Antibody (MO-AB-15911R)


Cat: MO-AB-15911R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCattle (Bos taurus)
CloneMO15911R
SpecificityThis antibody binds to Cattle MOG.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe product of this gene is a membrane protein expressed on the oligodendrocyte cell surface and the outermost surface of myelin sheaths. Due to this localization, it is a primary target antigen involved in immune-mediated demyelination. This protein may be involved in completion and maintenance of the myelin sheath and in cell-cell communication. Alternatively spliced transcript variants encoding different isoforms have been identified.
Product OverviewMouse Anti-Cattle MOG Antibody is a mouse antibody against MOG. It can be used for MOG detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesMyelin oligodendrocyte glycoprotein isoform alpha1; MOG
UniProt IDQ58CX4
Protein RefseqThe length of the protein is 246 amino acids long.
The sequence is show below: MASLLSSSLPSCLPSLLFLLLQLTSSSAGQFRVIGPGHPIRALVGDEVELPCRISPGKNATGMEVGWYRPPFSRVVHLYRNGKDQDEEQAPEYRGRTQLLKETIGEGKVTLRIRNVRFSDEGGFTCFFRDHSYQEEAAMELKVEDPFYWITPGVLVLIAVLPVLLLQITVGLVFLCLQRRLRGKLWAEIENLHRTFDPHFLMVPCWKITLFVIVPVLGPLVALIICYNWLHRRLAGQFLEELRNPF.
For Research Use Only | Not For Clinical Use.
Online Inquiry