Mouse Anti-Rat Mog Antibody (MO-AB-27143H)


Cat: MO-AB-27143H
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRat (Rattus norvegicus)
CloneMO27143C
SpecificityThis antibody binds to Rat Mog.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe product of this gene is a membrane protein expressed on the oligodendrocyte cell surface and the outermost surface of myelin sheaths. Due to this localization, it is a primary target antigen involved in immune-mediated demyelination. This protein may be involved in completion and maintenance of the myelin sheath and in cell-cell communication. Alternatively spliced transcript variants encoding different isoforms have been identified.
Product OverviewThis product is a mouse antibody against Mog. It can be used for Mog detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesMyelin oligodendrocyte glycoprotein; Myelin oligodendrocyte glycoprotein, isoform CRA_a; Myelin-oligodendrocyte glycoprotein; Mog
UniProt IDQ6MFX9
Protein RefseqThe length of the protein is 245 amino acids long.
The sequence is show below: MAGVWSLSLPSCLLSLLLLLQLSCSYAGQFRVIGPGHPIRALVGDEAELPCRISPGKNATGMEVGWYRSPFSRVVHLYRNGKDQDAEQAPEYRGRTELLKESIGEGKVALRIQNVRFSDEGGYTCFFRDHSYQEEAAVELKVEDPFYWINPGVLALIALVPMLLLQVSVGLVFLFLQHRLRGKLRAEVENLHRTFDPHFLRVPCWKITLFVIVPVLGPLVALIICYNWLHRRLAGQFLEELRNPF.
See other products for " MOG "
MO-AB-15911RMouse Anti-Cattle MOG Antibody (MO-AB-15911R)
MO-AB-12102YMouse Anti-O. mykiss MOG Antibody (MO-AB-12102Y)
CBMOAB-1726YCMouse Anti-E. coli mog Antibody (CBMOAB-1726YC)
CBMOAB-51566FYAMouse Anti-Rhesus MOG Antibody (CBMOAB-51566FYA)
MOFY-0722-FY349Rabbit Anti-MOG Antibody (MOFY-0722-FY349)
MOFY-0722-FY446Rabbit Anti-MOG Antibody (MOFY-0722-FY446)
MO-AB-59222WMouse Anti-Marmoset MOG Antibody (MO-AB-59222W)
MOFY-0722-FY100Biotin conjugated antibody to MOG Antibody (MOFY-0722-FY100)
MO-AB-27347RMouse Anti-Pig MOG Antibody (MO-AB-27347R)
For Research Use Only | Not For Clinical Use.
Online Inquiry