Mouse Anti-Cattle MRPL18 Antibody (MO-AB-15991R)


Cat: MO-AB-15991R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCattle (Bos taurus)
CloneMO15991R
SpecificityThis antibody binds to Cattle MRPL18.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationMitochondrion

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis nuclear gene encodes a protein component of the larger 39S subunit of mitochondrial ribosome. This protein may also aid in the import of nuclear-encoded 5S rRNA into mitochondria. Alternative splicing results in multiple transcript variants, most of which are not predicted to encode a protein. A pseudogene of this gene is found on chromosome 16.
Product OverviewMouse Anti-Cattle MRPL18 Antibody is a mouse antibody against MRPL18. It can be used for MRPL18 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative Names39S ribosomal protein L18, mitochondrial; L18mt; MRP-L18; MRPL18
UniProt IDQ3ZBR7
Protein RefseqThe length of the protein is 180 amino acids long.
The sequence is show below: MALRSRSWELLPVCRNPGCRVAAFSTSAKPVVKPEADPVGNEAVAPEFTNRNPRNLELLAVARKERGWGTVWPSREFWHRLRVIRSQHHIEALVEHRNGQVVVSASTREWAIKKHLYSTKSVVACESVGRVLAQRCLEAGINFMVYQPTPWEAASDSMKRLQIGMIEGGVVLQEPRRIYE.
For Research Use Only | Not For Clinical Use.
Online Inquiry