Mouse Anti-Rat Mrpl18 Antibody (MO-AB-27195H)


Cat: MO-AB-27195H
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRat (Rattus norvegicus)
CloneMO27195C
SpecificityThis antibody binds to Rat Mrpl18.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationMitochondrion

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis nuclear gene encodes a protein component of the larger 39S subunit of mitochondrial ribosome. This protein may also aid in the import of nuclear-encoded 5S rRNA into mitochondria. Alternative splicing results in multiple transcript variants, most of which are not predicted to encode a protein. A pseudogene of this gene is found on chromosome 16.
Product OverviewThis product is a mouse antibody against Mrpl18. It can be used for Mrpl18 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesMitochondrial ribosomal protein L18; Protein Mrpl18; Mitochondrial ribosomal protein L18; Mrpl18
UniProt IDB2RZ57
Protein RefseqThe length of the protein is 180 amino acids long.
The sequence is show below: MALQPRFWKCLSVCRNLECGFASLSTSSTPAVQPDVETKENEAVAPEFINRNPRNLELLGVARKERGWATVWPNREFWHRLRVVKTQHHVEAFVEHLNGQVVVSASTREWAIKKHLYSTRNVVACESVGRVLAQRCLEAGINFMVYQPTPWEASSDSIKRLQNAMTESGVMLREPRRVYE.
See other products for " mrpl18 "
CBMOAB-87368FYAMouse Anti-Zebrafish mrpl18 Antibody (CBMOAB-87368FYA)
MO-AB-05302HMouse Anti-Frog mrpl18 Antibody (MO-AB-05302H)
CBMOAB-06807HCBMouse Anti-C. elegans MRPL18 Antibody (CBMOAB-06807HCB)
MO-AB-59328WMouse Anti-Marmoset MRPL18 Antibody (MO-AB-59328W)
MO-DKB-01322WRabbit Anti-MRPL18 Antibody (MO-DKB-01322W)
MO-AB-15991RMouse Anti-Cattle MRPL18 Antibody (MO-AB-15991R)
CBMOAB-24692FYAMouse Anti-D. melanogaster Mrpl18 Antibody (CBMOAB-24692FYA)
MO-AB-12690WMouse Anti-Chimpanzee MRPL18 Antibody (MO-AB-12690W)
For Research Use Only | Not For Clinical Use.
Online Inquiry