Mouse Anti-Cattle MYL2 Antibody (MO-AB-16294R)


Cat: MO-AB-16294R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCattle (Bos taurus)
CloneMO16294R
SpecificityThis antibody binds to Cattle MYL2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationCytoskeleton; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionContractile protein that plays a role in heart development and function (By similarity). Following phosphorylation, plays a role in cross-bridge cycling kinetics and cardiac muscle contraction by increasing myosin lever arm stiffness and promoting myosin head diffusion; as a consequence of the increase in maximum contraction force and calcium sensitivity of contraction force. These events altogether slow down myosin kinetics and prolong duty cycle resulting in accumulated myosins being cooperatively recruited to actin binding sites to sustain thin filament activation as a means to fine-tune myofilament calcium sensitivity to force (By similarity). During cardiogenesis plays an early role in cardiac contractility by promoting cardiac myofibril assembly (By similarity).
Product OverviewMouse Anti-Cattle MYL2 Antibody is a mouse antibody against MYL2. It can be used for MYL2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesMyosin regulatory light chain 2, ventricular/cardiac muscle isoform; MLC-2; MLC-2v; MYL2
UniProt IDQ3SZE5
Protein RefseqThe length of the protein is 166 amino acids long.
The sequence is show below: MSPKKAKKRAEGANYNVFSMFEQTQIQEFKEAFTIMDQNRDGFIDKNDLRDTFAALGRVNVKNEEIDEMLKEAPGPINFTVFLQMFGEKLKGADPEETILNAFKVFDPEGKGVLKADYIKEMLTTQAERFSKEEIDQMFAAFPPDVTGNLDYKNLVHIITHGEEKD.
For Research Use Only | Not For Clinical Use.
Online Inquiry