Connect with Us at the Upcoming Events

Creative Biolabs is excited to greet you at the upcoming international conferences. Meet our team at the 13th Annual World ADC San Diego and the 13th Annual World Multispecific Summit in September, the 10th Annual Immuno-Oncology Summit in October, and the Antibody Engineering & Therapeutics (US) 2022 in December for expert consultation on your drug discovery projects. Shoot an email to arrange an in-person meeting!

Mouse Anti-Frog myl2 Antibody (MO-AB-05414H)


Cat: MO-AB-05414H
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityFrog (Xenopus laevis)
CloneMO05414C
SpecificityThis antibody binds to Frog myl2.
FormatLyophilized
StorageStore at 4°C: short-term (1-2 weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThus gene encodes the regulatory light chain associated with cardiac myosin beta (or slow) heavy chain. Ca+ triggers the phosphorylation of regulatory light chain that in turn triggers contraction. Mutations in this gene are associated with mid-left ventricular chamber type hypertrophic cardiomyopathy.
Product OverviewThis product is a mouse antibody against myl2. It can be used for myl2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesMGC85379 protein; myl2; MGC85379
UniProt IDQ66KW3
Protein RefseqThe length of the protein is 167 amino acids long.
The sequence is show below: MSPKKAKKRSEGGSSNVFSMFEQTQIQEFKEAFTIMDQNRDGFIDKDDLRDTFAALGRLNVKNEELDEMLKEAPGPINFTVFLTMFGEKLKGADPEETILNAFKVFDPEGIGLLKSEYIREMLMTQAERFTSEEVDQMFTAFPPDVTGNLNYKNLVHIITHGEEKEE.
For Research Use Only | Not For Clinical Use.

Online Inquiry