Mouse Anti-Cattle NEK2 Antibody (MO-AB-16655R)


Cat: MO-AB-16655R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCattle (Bos taurus)
CloneMO16655R
SpecificityThis antibody binds to Cattle NEK2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationOther locations; Nucleus; Cytoskeleton

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a serine / threonine-protein kinase that is involved in mitotic regulation. This protein is localized to the centrosome, and undetectable during G1 phase, but accumulates progressively throughout the S phase, reaching maximal levels in late G2 phase. Alternatively spliced transcript variants encoding different isoforms with distinct C-termini have been noted for this gene.
Product OverviewThis product is a mouse antibody against NEK2. It can be used for NEK2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesNIMA (Never in mitosis gene a)-related kinase 2; NEK2
UniProt IDQ2KIQ0
Protein RefseqThe length of the protein is 383 amino acids long.
The sequence is show below: MPTRVEDYEVLYTIGTGSYGRCQKIRRKSDGKILVWKELDYGSMTENEKQMLVSEVNLLRELKHPNIVRYYDRIIDRTNTTLYIVMECCEGGDLASVIAKGTKERQYLDEEFVLRVMAQLTLALKECHRRSDGGHTVLHRDLKPANVFLDGKQNVKLGDFGLARILNHDTSFAKTFVGTPYYMSPEQMNHMSYNEKSDIWSLGCLLYELCALMPPFTAFNQKELAGKIREGKFRRIPYRYSDELNDIITRMLNLK.
For Research Use Only | Not For Clinical Use.
Online Inquiry