Mouse Anti-Zebrafish nek2 Antibody (CBMOAB-88732FYA)


Cat: CBMOAB-88732FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio)
CloneMO88732FYA
SpecificityThis antibody binds to Zebrafish nek2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus; Cytoskeleton; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a serine/threonine-protein kinase that is involved in mitotic regulation. This protein is localized to the centrosome, and undetectable during G1 phase, but accumulates progressively throughout the S phase, reaching maximal levels in late G2 phase. Alternatively spliced transcript variants encoding different isoforms with distinct C-termini have been noted for this gene.
Product OverviewMouse Anti-Zebrafish nek2 Antibody is a mouse antibody against nek2. It can be used for nek2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesNIMA (Never in mitosis gene a)-related kinase 2; Nek2 protein; nek
UniProt IDQ7ZUN2
Protein RefseqThe length of the protein is 440 amino acids long.
The sequence is show below: MPSKTEDYEVLLTIGCGSYGKCQKIKRKSDGKILVWKVLDYGTMAEGEKQMLVSEVNLLRELKHPNIVRYHDRIIDRTNTTLYIVMEYCEGGDLASLINRSIKDKRYLEEEFILRVMAQLSLALKECHGRSNGSSTVLHRDLKPANIFLDAKQNVKLGDFGLARILNHDTSFAKTFVGTPYYMSPEQMNRMSYNEKSDIWSLGCLLYELCALSPPFTAYNQTELARKIREGRFRRIPYRYSDELNTLLSKMLNLKDYLRPSVESILQNGLISGYVALEQKRLQEKQRRRSDEAEQPKHPESPLLAELRLKEQILREREQALKEREQRLEQREQELCVREQQTNEKLVRAESMLKAFNLIRQQRALSLLSASDTENEENISPGKKRVHFAGDGKENGRLIMKPQEHILEKRHQLMNKRIQTLGEEEKMIHSPKHREMQGIR.
For Research Use Only | Not For Clinical Use.
Online Inquiry