Mouse Anti-Cattle NPC2 Antibody (MO-AB-16872R)


Cat: MO-AB-16872R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCattle (Bos taurus)
CloneMO16872R
SpecificityThis antibody binds to Cattle NPC2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationExtracellular region or secreted; Lysosome; Endoplasmic reticulum

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a protein containing a lipid recognition domain. The encoded protein may function in regulating the transport of cholesterol through the late endosomal/lysosomal system. Mutations in this gene have been associated with Niemann-Pick disease, type C2 and frontal lobe atrophy. [provided by RefSeq, Jul 2008]
Product OverviewThis product is a mouse antibody against NPC2. It can be used for NPC2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesEpididymal secretory protein E1; EPV20; Niemann Pick type C2 protein homolog; NPC2
UniProt IDP79345
Protein RefseqThe length of the protein is 149 amino acids long.
The sequence is show below: MRFLTVAFLFLALSASALAEPVKFKDCGSWVGVIKEVNVSPCPTQPCKLHRGQSYSVNVTFTSNTQSQSSKAVVHGIVMGIPVPFPIPESDGCKSGIRCPIEKDKTYNYVNKLPVKNEYPSIKVVVEWELTDDKNQRFFCWQIPIEVEA.
For Research Use Only | Not For Clinical Use.
Online Inquiry