Mouse Anti-Zebrafish npc2 Antibody (CBMOAB-89710FYA)


Cat: CBMOAB-89710FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio)
CloneMO89710FYA
SpecificityThis antibody binds to Zebrafish npc2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationEndoplasmic reticulum; Extracellular region or secreted; Lysosome

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a protein containing a lipid recognition domain. The encoded protein may function in regulating the transport of cholesterol through the late endosomal/lysosomal system. Mutations in this gene have been associated with Niemann-Pick disease, type C2 and frontal lobe atrophy.
Product OverviewMouse Anti-Zebrafish npc2 Antibody is a mouse antibody against npc2. It can be used for npc2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesEpididymal secretory protein E1; 16.5 kDa secretory protein; Niemann Pick type C2 protein homolog; npc
UniProt IDQ9DGJ3
Protein RefseqThe length of the protein is 149 amino acids long.
The sequence is show below: MDYRVLGVVLLSFLAYTCADPVKFVDCGSVDGKVVQVDIKPCSQQPCKLHKGQSYTVNVTFSSGVESQTSKAVVHGVLAGVPVPFPIPIDDGCKSGIQCPIVPQKPYNYVTELPVKTEYPAIKVVVEWELRDDSSKDLFCIKFPVQIVN.
For Research Use Only | Not For Clinical Use.
Online Inquiry